Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_K06 (459 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O13035|SAP_CHICK Proactivator polypeptide precursor [Con... 51 1e-06 sp|P10960|SAP_RAT Sulfated glycoprotein 1 precursor (SGP-1)... 49 5e-06 sp|P26779|SAP_BOVIN Proactivator polypeptide precursor [Con... 49 5e-06 sp|P07602|SAP_HUMAN Proactivator polypeptide precursor [Con... 47 3e-05 sp|Q61207|SAP_MOUSE Sulfated glycoprotein 1 precursor (SGP-... 47 3e-05 sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protei... 38 0.012 sp|P17129|PSPB_CANFA Pulmonary surfactant-associated protei... 34 0.18 sp|Q9H000|MKRN2_HUMAN Makorin-2 (RING finger protein 62) 32 0.88 sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase... 31 1.5 sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase... 31 1.5
>sp|O13035|SAP_CHICK Proactivator polypeptide precursor [Contains: Saposin A; Saposin B; Saposin C; Saposin D] Length = 518 Score = 51.2 bits (121), Expect = 1e-06 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 176 CEMTKMCSHQRKNPLGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C +C +K LG++ C WGPG+WC + + A C AV HC +VW Sbjct: 470 CTKLGVCGAAKKPLLGEDACVWGPGYWCKNMETAAQC--NAVDHCRRHVW 517
Score = 40.8 bits (94), Expect = 0.001 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 218 LGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 L + C GP WC S + A CG AVKHC+ NVW Sbjct: 21 LWQKDCAKGPEVWCQSLRTASQCG--AVKHCQQNVW 54
>sp|P10960|SAP_RAT Sulfated glycoprotein 1 precursor (SGP-1) (Prosaposin) Length = 554 Score = 48.9 bits (115), Expect = 5e-06 Identities = 20/50 (40%), Positives = 26/50 (52%) Frame = +2 Query: 176 CEMTKMCSHQRKNPLGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C +C K LG C WGPG+WC + + A C AV HC+ +VW Sbjct: 506 CSKIGVCPSAYKLLLGTEKCVWGPGYWCQNSETAARC--NAVDHCKRHVW 553
>sp|P26779|SAP_BOVIN Proactivator polypeptide precursor [Contains: Saposin A (Protein A); Saposin B (Sphingolipid activator protein 1) (SAP-1) (Cerebroside sulfate activator) (CSAct) (Dispersin) (Sulfatide/GM1 activator); Saposin C (Co-beta-glucosidase) (A1 activator) (Glucosylceramidase activator) (Sphingolipid activator protein 2) (SAP-2); Saposin D (Protein C) (Component C)] Length = 525 Score = 48.9 bits (115), Expect = 5e-06 Identities = 27/105 (25%), Positives = 42/105 (40%), Gaps = 1/105 (0%) Frame = +2 Query: 14 QTISSKSSHSNLLFGLVSFCNQISAHERLECLKQFRNFNAVIAAFNKSKTINEF-CEMTK 190 + + S+ +L L C+ + R +C + + V+ F C Sbjct: 422 RNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIG 481 Query: 191 MCSHQRKNPLGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C K LG C WGP +WC + + A C AV+HC +VW Sbjct: 482 ACPAAHKPLLGAEKCVWGPSYWCQNMESAALC--NAVEHCRRHVW 524
Score = 36.6 bits (83), Expect = 0.027 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +2 Query: 218 LGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 LG CT G WC + K A C GAV+HC VW Sbjct: 20 LGLRECTRGSAVWCQNVKTAADC--GAVQHCLQTVW 53
>sp|P07602|SAP_HUMAN Proactivator polypeptide precursor [Contains: Saposin A (Protein A); Saposin B-Val; Saposin B (Sphingolipid activator protein 1) (SAP-1) (Cerebroside sulfate activator) (CSAct) (Dispersin) (Sulfatide/GM1 activator); Saposin C (Co-beta-glucosidase) (A1 activator) (Glucosylceramidase activator) (Sphingolipid activator protein 2) (SAP-2); Saposin D (Protein C) (Component C)] Length = 524 Score = 46.6 bits (109), Expect = 3e-05 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 1/105 (0%) Frame = +2 Query: 14 QTISSKSSHSNLLFGLVSFCNQISAHERLECLKQFRNFNAVIAAFNKSKTINEF-CEMTK 190 + + S+ +L L C+ + + +C + + V+ F C Sbjct: 421 RNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIG 480 Query: 191 MCSHQRKNPLGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C K LG C WGP +WC + + A C AV+HC+ +VW Sbjct: 481 ACPSAHKPLLGTEKCIWGPSYWCQNTETAAQC--NAVEHCKRHVW 523
Score = 37.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +2 Query: 218 LGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVWRQ 331 LG CT G WC + K A C GAVKHC VW + Sbjct: 20 LGLKECTRGSAVWCQNVKTASDC--GAVKHCLQTVWNK 55
>sp|Q61207|SAP_MOUSE Sulfated glycoprotein 1 precursor (SGP-1) (Prosaposin) Length = 557 Score = 46.6 bits (109), Expect = 3e-05 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +2 Query: 176 CEMTKMCSHQRKNPLGKNPCTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C +C K LG C WGP +WC + + A C AV HC+ +VW Sbjct: 509 CSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARC--NAVDHCKRHVW 556
Score = 31.2 bits (69), Expect = 1.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 233 CTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C+ G C K AV CG AVKHC+ VW Sbjct: 25 CSGGSAVLCRDVKTAVDCG--AVKHCQQMVW 53
>sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe)) Length = 377 Score = 37.7 bits (86), Expect = 0.012 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 233 CTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C GP FWC S +HAV C A+ HC VW Sbjct: 31 CAQGPQFWCQSLEHAVQC--RALGHCLQEVW 59
>sp|P17129|PSPB_CANFA Pulmonary surfactant-associated protein B precursor (SP-B) (6 kDa protein) (Pulmonary surfactant-associated proteolipid SPL(Phe)) (Pulmonary surfactant protein 18) (SP 18) Length = 363 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 233 CTWGPGFWCVSRKHAVACGPGAVKHCEMNVW 325 C GP FWC S + A+ C A+ HC VW Sbjct: 25 CARGPAFWCQSLEQALQC--RALGHCLQEVW 53
>sp|Q9H000|MKRN2_HUMAN Makorin-2 (RING finger protein 62) Length = 416 Score = 31.6 bits (70), Expect = 0.88 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +2 Query: 11 LQTISSKSSHSNLLFGLVSFCNQ---ISAHERLECLKQFRNFNAVIAAFNKSKTINEF 175 ++ I K+S S FG++S CN +S + C KQF N +I + + + I+EF Sbjct: 242 MEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFE--NPIIKSCPECRVISEF 297
>sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 (Ubiquitin thiolesterase 22) (Ubiquitin-specific processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 397 CELKNSSSL---KSSIRIVELYNGHLSPHIHFTMFHCTGT 287 CE+++ SS + S E Y+GH SPHI + + H T Sbjct: 211 CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWT 250
>sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 (Ubiquitin thiolesterase 22) (Ubiquitin-specific processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 397 CELKNSSSL---KSSIRIVELYNGHLSPHIHFTMFHCTGT 287 CE+++ SS + S E Y+GH SPHI + + H T Sbjct: 211 CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWT 250
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,394,183 Number of Sequences: 369166 Number of extensions: 1102439 Number of successful extensions: 2407 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2402 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2534533995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)