Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_J24 (695 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O42237|SEM3E_CHICK Semaphorin-3E precursor (Collapsin-5)... 32 1.2 sp|Q9RPQ5|HIS4_THEET 1-(5-phosphoribosyl)-5-[(5-phosphoribo... 31 3.6 sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40-containing subunit B... 30 4.7 sp|O15041|SEM3E_HUMAN Semaphorin-3E precursor 30 4.7 sp|Q90665|SEM4D_CHICK Semaphorin-4D (Collapsin-4) (COLL-4) 30 4.7
>sp|O42237|SEM3E_CHICK Semaphorin-3E precursor (Collapsin-5) (COLL-5) Length = 785 Score = 32.3 bits (72), Expect = 1.2 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 363 YNFPMVAVEDERALLYHESIFDIVFMDTDNGGRCGIATLYNGIEESQIIDCLNHIRTIKI 542 YN +AV+ A + +D++F+ TDNG + T+YN ES L ++ K+ Sbjct: 435 YNLKQIAVDRVEA---EDGQYDVLFIGTDNGIVLKVITIYNQETESMEEVILEELQVFKV 491
>sp|Q9RPQ5|HIS4_THEET 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) Length = 237 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/67 (28%), Positives = 34/67 (50%) Frame = +3 Query: 369 FPMVAVEDERALLYHESIFDIVFMDTDNGGRCGIATLYNGIEESQIIDCLNHIRTIKIQG 548 +P V ++D R + + FD V + +DN G+ G + ++D L+ RT +IQ Sbjct: 4 YPAVDIKDGRCVRLVQGEFDKVTVYSDNPVEMGLKWERMGAQYLHVVD-LDGARTGQIQN 62 Query: 549 KPLFGEL 569 P+ E+ Sbjct: 63 TPIISEM 69
>sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40-containing subunit B1 homolog 1 Length = 837 Score = 30.4 bits (67), Expect = 4.7 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +3 Query: 471 ATLYNGIEESQIIDCLNHIRTIKIQGKPLFGELMWLADVQVD--ADQPPEKKVRCLME*V 644 A L +G+++ + ++ +++ G P++ L A V VD A+Q E+ RC +E Sbjct: 746 ALLGSGMDQHLSVSLDLLLKLVRLYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELE 805 Query: 645 LINVCL 662 + CL Sbjct: 806 KVKACL 811
>sp|O15041|SEM3E_HUMAN Semaphorin-3E precursor Length = 775 Score = 30.4 bits (67), Expect = 4.7 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +3 Query: 363 YNFPMVAVEDERALLYHESIFDIVFMDTDNGGRCGIATLYNGIEESQIIDCLNHIRTIK 539 YN +AV+ A + +D++F+ TDNG + T+YN ES L ++ K Sbjct: 431 YNLKQIAVDRVEA---EDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILEELQIFK 486
>sp|Q90665|SEM4D_CHICK Semaphorin-4D (Collapsin-4) (COLL-4) Length = 295 Score = 30.4 bits (67), Expect = 4.7 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +3 Query: 369 FPMVAVEDERALLYHESIFDIVFMDTDNGGRCGIATLYNG---IEESQIIDCLNHIRTIK 539 + + V+ RAL + +I+D++F+ TD G + NG IEE+Q+ ++T+ Sbjct: 193 YTQIVVDRVRAL--NGTIYDVMFISTDQGALHKAISYENGMHIIEETQLFPKFEPVQTLL 250 Query: 540 IQGK 551 + K Sbjct: 251 LSSK 254
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,010,072 Number of Sequences: 369166 Number of extensions: 1723611 Number of successful extensions: 4038 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4037 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6024953540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)