Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_J03 (383 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB 30 1.7 sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) 29 2.9 sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (... 29 3.8
>sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB Length = 373 Score = 30.0 bits (66), Expect = 1.7 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +1 Query: 109 WADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 288 +A GE++ K GG AR + VVVG G + Y HR+D++E Sbjct: 213 YATGEHLRKAVPSGG---------ARHPIEFYVVVGDEIAGIEAGVYHYNVRHHRLDAIE 263 Query: 289 VLCCSTK 309 + S K Sbjct: 264 IASTSLK 270
>sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) Length = 994 Score = 29.3 bits (64), Expect = 2.9 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 8/92 (8%) Frame = +1 Query: 22 AYGGAEHSKNYYEVLVESSILNHKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGG 201 A G + + Y+ LVE G+ W W D A+ G+ DG P++ + G Sbjct: 514 AMGNSPGDLHAYQTLVEQYDSFIGGFVWEWCD------HAIQTGMKDGNPIFRYGGDFGE 567 Query: 202 QV------VVGKYFPQH--GCGYFPYGGEEHR 273 ++ V G FP GY+ + +EHR Sbjct: 568 KLHDGNFCVDGIVFPNRVPHEGYYEF-KQEHR 598
>sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (Ajl-2) Length = 166 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +1 Query: 88 HKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEE 267 H+G W W+DG + N G+P ++ GG + C + YGG++ Sbjct: 100 HEGRSWLWSDGTSASAEGDFSMWNPGEP-----NDAGG---------KEDCVHDNYGGQK 145 Query: 268 H 270 H Sbjct: 146 H 146
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,254,374 Number of Sequences: 369166 Number of extensions: 955402 Number of successful extensions: 2834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2829 length of database: 68,354,980 effective HSP length: 94 effective length of database: 50,989,890 effective search space used: 1682666370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)