Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_F14 (365 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Z4W7|TRPE_STRCO Anthranilate synthase component I 29 3.9 sp|O13290|DYHC_SCHPO Dynein heavy chain, cytosolic (DYHC) 28 5.1 sp|Q9WIK0|REP7_FBNY1 Replication-associated protein 7 (Rep7) 28 6.6
>sp|Q9Z4W7|TRPE_STRCO Anthranilate synthase component I Length = 511 Score = 28.9 bits (63), Expect = 3.9 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 157 PMETGTPPG*PQWAFLILICHRSAGDI*IF-HSISNILLASFHSP 26 P+ G PPG P+ AFL +A D+ +F H+ +LL + + P Sbjct: 152 PLAAGPPPGLPESAFL------AADDLVVFDHATRRVLLMTLYRP 190
>sp|O13290|DYHC_SCHPO Dynein heavy chain, cytosolic (DYHC) Length = 4196 Score = 28.5 bits (62), Expect = 5.1 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 14/58 (24%) Frame = +1 Query: 10 FLVAVMENETMPIKCWK-----WSEIFK---------YHQLSGDKSESRMPTVVSLEE 141 F V+ N C K WS FK + ++ D+SESRMPT+V L E Sbjct: 3856 FCTEVLANTHCEEDCLKLLYDLWSSAFKVEFSNIKYDFLKIINDESESRMPTIVYLME 3913
>sp|Q9WIK0|REP7_FBNY1 Replication-associated protein 7 (Rep7) Length = 283 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 210 RCSNQKMAISCSWQFAYFPWKRELLQ 133 R +K+ SC+W F PW+ ELL+ Sbjct: 131 RVQMKKIRESCTWNFDLRPWQDELLK 156
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,888,823 Number of Sequences: 369166 Number of extensions: 698258 Number of successful extensions: 1429 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1429 length of database: 68,354,980 effective HSP length: 88 effective length of database: 52,098,300 effective search space used: 1719243900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)