Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_M07 (289 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q90YK5|HPSE_CHICK Heparanase precursor 31 1.0 sp|Q7N622|SYN_PHOLL Asparaginyl-tRNA synthetase (Asparagine... 28 6.5 sp|P83122|GLB1_PHEHI Globin I, extracellular (Erythrocruorin) 28 8.5
>sp|Q90YK5|HPSE_CHICK Heparanase precursor Length = 523 Score = 30.8 bits (68), Expect = 1.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 143 DHTWETRIVSMFRTKSSFHQWPSF 214 D TWE +++S F+ K WPSF Sbjct: 89 DSTWEEKVLSEFQAKDVCEAWPSF 112
>sp|Q7N622|SYN_PHOLL Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) Length = 466 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 51 KSFVKIGNDVFSAEAAIEVKVSLNGQCYLCSIT 149 K V D F EA + V LNG+ Y C+++ Sbjct: 192 KGEVDFNQDFFGREAFLTVSGQLNGEAYACALS 224
>sp|P83122|GLB1_PHEHI Globin I, extracellular (Erythrocruorin) Length = 140 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 134 FVLDHTWETRIVSMFRTKSSFHQWPSFL 217 F + H W+T RT+ S H W FL Sbjct: 8 FKVKHQWQTVFSEAHRTEFSLHFWKEFL 35
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,092,556 Number of Sequences: 369166 Number of extensions: 461265 Number of successful extensions: 975 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 68,354,980 effective HSP length: 65 effective length of database: 56,347,205 effective search space used: 1690416150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)