Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_K16 (269 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P55884|IF39_HUMAN Eukaryotic translation initiation fact... 28 5.1 sp|Q82GV2|FBIC_STRAW FO synthase (7,8-didemethyl-8-hydroxy-... 28 6.6 sp|Q5UZE6|SYA_HALMA Alanyl-tRNA synthetase (Alanine--tRNA l... 28 6.6 sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-as... 28 8.7 sp|Q9WV55|VAPA_MOUSE Vesicle-associated membrane protein-as... 28 8.7
>sp|P55884|IF39_HUMAN Eukaryotic translation initiation factor 3 subunit 9 (eIF-3 eta) (eIF3 p116) (eIF3 p110) (eIF3b) Length = 814 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 10 EMEWPPQNRYMCTS-TWTI*TGYKIPNVGWTW 102 ++EW P RY+ TS +W +K+ N W W Sbjct: 656 DVEWDPTGRYVVTSVSW---WSHKVDNAYWLW 684
>sp|Q82GV2|FBIC_STRAW FO synthase (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase) Length = 861 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +2 Query: 8 VKWNGHRRIDTCAPPHGQFKPGTKFPMWDGPGYYGYYHEALDRHSAGEFRTL 163 + W +R+ AP G T +W PG G +H + D+ A R L Sbjct: 181 MSWTDFQRLKPVAPSMGMMLETTATRLWSEPG--GPHHGSPDKEPAVRLRVL 230
>sp|Q5UZE6|SYA_HALMA Alanyl-tRNA synthetase (Alanine--tRNA ligase) (AlaRS) Length = 927 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 7 GEMEWPPQNRYMCTSTWTI*TGYKIPNVGWTWL 105 GE E NRY T+ + TGY + WTW+ Sbjct: 235 GEYEMKDGNRYSPMDTYIVDTGYGLER--WTWM 265
>sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A (VAMP-associated protein A) (VAMP-A) (VAP-A) (33 kDa Vamp-associated protein) (VAP-33) Length = 242 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 152 TRLRCVYPMPRDNNHNNQVHPTLGI 78 ++LRCV+ MP +N+ N + P+ + Sbjct: 117 SKLRCVFEMPNENDKLNDMEPSKAV 141
>sp|Q9WV55|VAPA_MOUSE Vesicle-associated membrane protein-associated protein A (VAMP-associated protein A) (VAMP-A) (VAP-A) (33 kDa Vamp-associated protein) (VAP-33) Length = 242 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 152 TRLRCVYPMPRDNNHNNQVHPTLGI 78 ++LRCV+ MP +N+ N + P+ + Sbjct: 117 SKLRCVFEMPNENDKLNDMEPSKAV 141
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,785,106 Number of Sequences: 369166 Number of extensions: 794611 Number of successful extensions: 1901 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1900 length of database: 68,354,980 effective HSP length: 59 effective length of database: 57,455,615 effective search space used: 1723668450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)