Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_K08 (355 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q80944|VE2_HPV60 Regulatory protein E2 30 2.2 sp|P81282|CSPG2_BOVIN Versican core protein precursor (Larg... 28 6.5
>sp|Q80944|VE2_HPV60 Regulatory protein E2 Length = 404 Score = 29.6 bits (65), Expect = 2.2 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = +1 Query: 79 YRQNGAAYVNIFGKVISAEESSVQKVYKDDNCYLCNVKPAKTGRLPSFTCEGPSPVSTNG 258 Y Q G V+ ++ISA +S K DD +K G+ P F SP +T+G Sbjct: 182 YSQTGTWTVHYKNQIISAPVTSSSKQSSDDYT-------SKAGQQPHFFASSSSPTTTDG 234
>sp|P81282|CSPG2_BOVIN Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) Length = 3381 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 151 KVYKDDNCYLCNVKPAKTGRLPSFTCEGPSPVSTNGK 261 K + D N Y+ V+ KTGR+ F+ G P+ + K Sbjct: 1318 KFHPDINVYIIEVRENKTGRMSDFSVSG-HPIDSESK 1353
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,896,471 Number of Sequences: 369166 Number of extensions: 641630 Number of successful extensions: 1347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1346 length of database: 68,354,980 effective HSP length: 85 effective length of database: 52,652,505 effective search space used: 1684880160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)