Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_016_G23
(205 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|P25782|CYSP2_HOMAM Digestive cysteine proteinase 2 precu... 55 4e-08
sp|Q26636|CATL_SARPE Cathepsin L precursor [Contains: Cathe... 55 5e-08
sp|Q95029|CATL_DROME Cathepsin L precursor (Cysteine protei... 53 2e-07
sp|Q10991|CATL_SHEEP Cathepsin L [Contains: Cathepsin L hea... 51 9e-07
sp|P13277|CYSP1_HOMAM Digestive cysteine proteinase 1 precu... 50 1e-06
sp||P09648_2 [Segment 2 of 2] Cathepsin L [Contains: Cathep... 50 2e-06
sp|Q24940|CATLP_FASHE Cathepsin L-like proteinase precursor 50 2e-06
sp|Q9GL24|CATL_CANFA Cathepsin L precursor [Contains: Cathe... 49 3e-06
sp|P25975|CATL_BOVIN Cathepsin L precursor [Contains: Cathe... 49 3e-06
sp|O60911|CATL2_HUMAN Cathepsin L2 precursor (Cathepsin V) ... 49 5e-06
>sp|P25782|CYSP2_HOMAM Digestive cysteine proteinase 2 precursor
Length = 323
Score = 55.5 bits (132), Expect = 4e-08
Identities = 23/32 (71%), Positives = 27/32 (84%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W T+WGD+GYIKM R+ NN CGIAT AS+PLV
Sbjct: 292 WATSWGDAGYIKMSRNRNNNCGIATVASYPLV 323
>sp|Q26636|CATL_SARPE Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin
L light chain]
Length = 339
Score = 55.1 bits (131), Expect = 5e-08
Identities = 22/32 (68%), Positives = 26/32 (81%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W TTWG+ GYIKM R+ NN CGIATA+S+P V
Sbjct: 308 WGTTWGEQGYIKMARNQNNQCGIATASSYPTV 339
>sp|Q95029|CATL_DROME Cathepsin L precursor (Cysteine proteinase 1) [Contains: Cathepsin
L heavy chain; Cathepsin L light chain]
Length = 341
Score = 52.8 bits (125), Expect = 2e-07
Identities = 21/32 (65%), Positives = 26/32 (81%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W TTWGD G+IKM R+ N CGIA+A+S+PLV
Sbjct: 310 WGTTWGDKGFIKMLRNKENQCGIASASSYPLV 341
>sp|Q10991|CATL_SHEEP Cathepsin L [Contains: Cathepsin L heavy chain; Cathepsin L light
chain]
Length = 217
Score = 50.8 bits (120), Expect = 9e-07
Identities = 20/32 (62%), Positives = 24/32 (75%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W WG+ GY+KM +D NN CGIATAAS+P V
Sbjct: 186 WGPEWGNKGYVKMAKDQNNHCGIATAASYPTV 217
>sp|P13277|CYSP1_HOMAM Digestive cysteine proteinase 1 precursor
Length = 322
Score = 50.4 bits (119), Expect = 1e-06
Identities = 21/32 (65%), Positives = 25/32 (78%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W T+WG+SGYIKM R+ NN CGIAT A +P V
Sbjct: 291 WATSWGESGYIKMARNRNNNCGIATDACYPTV 322
>sp||P09648_2 [Segment 2 of 2] Cathepsin L [Contains: Cathepsin L heavy chain;
Cathepsin L light chain]
Length = 42
Score = 50.1 bits (118), Expect = 2e-06
Identities = 21/32 (65%), Positives = 23/32 (71%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W WGD GYI M +D N CGIATAAS+PLV
Sbjct: 11 WGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 42
>sp|Q24940|CATLP_FASHE Cathepsin L-like proteinase precursor
Length = 326
Score = 49.7 bits (117), Expect = 2e-06
Identities = 20/35 (57%), Positives = 26/35 (74%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV*KF 105
W T WG+ GYI+M R+ NMCGIA+ AS P+V +F
Sbjct: 291 WGTYWGERGYIRMARNRGNMCGIASLASLPMVARF 325
>sp|Q9GL24|CATL_CANFA Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin
L light chain]
Length = 333
Score = 49.3 bits (116), Expect = 3e-06
Identities = 20/32 (62%), Positives = 24/32 (75%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W WG +GY+KM +D NN CGIATAAS+P V
Sbjct: 302 WGPEWGWNGYVKMAKDQNNHCGIATAASYPTV 333
>sp|P25975|CATL_BOVIN Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin
L light chain]
Length = 334
Score = 49.3 bits (116), Expect = 3e-06
Identities = 20/32 (62%), Positives = 24/32 (75%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W WG +GY+KM +D NN CGIATAAS+P V
Sbjct: 303 WGPEWGWNGYVKMAKDQNNHCGIATAASYPTV 334
>sp|O60911|CATL2_HUMAN Cathepsin L2 precursor (Cathepsin V) (Cathepsin U)
Length = 334
Score = 48.5 bits (114), Expect = 5e-06
Identities = 19/32 (59%), Positives = 24/32 (75%)
Frame = +1
Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96
W WG +GY+K+ +D NN CGIATAAS+P V
Sbjct: 303 WGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,246,103
Number of Sequences: 369166
Number of extensions: 331772
Number of successful extensions: 897
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 864
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 875
length of database: 68,354,980
effective HSP length: 39
effective length of database: 61,150,315
effective search space used: 1712208820
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)