Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_G23 (205 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P25782|CYSP2_HOMAM Digestive cysteine proteinase 2 precu... 55 4e-08 sp|Q26636|CATL_SARPE Cathepsin L precursor [Contains: Cathe... 55 5e-08 sp|Q95029|CATL_DROME Cathepsin L precursor (Cysteine protei... 53 2e-07 sp|Q10991|CATL_SHEEP Cathepsin L [Contains: Cathepsin L hea... 51 9e-07 sp|P13277|CYSP1_HOMAM Digestive cysteine proteinase 1 precu... 50 1e-06 sp||P09648_2 [Segment 2 of 2] Cathepsin L [Contains: Cathep... 50 2e-06 sp|Q24940|CATLP_FASHE Cathepsin L-like proteinase precursor 50 2e-06 sp|Q9GL24|CATL_CANFA Cathepsin L precursor [Contains: Cathe... 49 3e-06 sp|P25975|CATL_BOVIN Cathepsin L precursor [Contains: Cathe... 49 3e-06 sp|O60911|CATL2_HUMAN Cathepsin L2 precursor (Cathepsin V) ... 49 5e-06
>sp|P25782|CYSP2_HOMAM Digestive cysteine proteinase 2 precursor Length = 323 Score = 55.5 bits (132), Expect = 4e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W T+WGD+GYIKM R+ NN CGIAT AS+PLV Sbjct: 292 WATSWGDAGYIKMSRNRNNNCGIATVASYPLV 323
>sp|Q26636|CATL_SARPE Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 339 Score = 55.1 bits (131), Expect = 5e-08 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W TTWG+ GYIKM R+ NN CGIATA+S+P V Sbjct: 308 WGTTWGEQGYIKMARNQNNQCGIATASSYPTV 339
>sp|Q95029|CATL_DROME Cathepsin L precursor (Cysteine proteinase 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 52.8 bits (125), Expect = 2e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W TTWGD G+IKM R+ N CGIA+A+S+PLV Sbjct: 310 WGTTWGDKGFIKMLRNKENQCGIASASSYPLV 341
>sp|Q10991|CATL_SHEEP Cathepsin L [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 217 Score = 50.8 bits (120), Expect = 9e-07 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W WG+ GY+KM +D NN CGIATAAS+P V Sbjct: 186 WGPEWGNKGYVKMAKDQNNHCGIATAASYPTV 217
>sp|P13277|CYSP1_HOMAM Digestive cysteine proteinase 1 precursor Length = 322 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W T+WG+SGYIKM R+ NN CGIAT A +P V Sbjct: 291 WATSWGESGYIKMARNRNNNCGIATDACYPTV 322
>sp||P09648_2 [Segment 2 of 2] Cathepsin L [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 42 Score = 50.1 bits (118), Expect = 2e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W WGD GYI M +D N CGIATAAS+PLV Sbjct: 11 WGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 42
>sp|Q24940|CATLP_FASHE Cathepsin L-like proteinase precursor Length = 326 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV*KF 105 W T WG+ GYI+M R+ NMCGIA+ AS P+V +F Sbjct: 291 WGTYWGERGYIRMARNRGNMCGIASLASLPMVARF 325
>sp|Q9GL24|CATL_CANFA Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 333 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W WG +GY+KM +D NN CGIATAAS+P V Sbjct: 302 WGPEWGWNGYVKMAKDQNNHCGIATAASYPTV 333
>sp|P25975|CATL_BOVIN Cathepsin L precursor [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W WG +GY+KM +D NN CGIATAAS+P V Sbjct: 303 WGPEWGWNGYVKMAKDQNNHCGIATAASYPTV 334
>sp|O60911|CATL2_HUMAN Cathepsin L2 precursor (Cathepsin V) (Cathepsin U) Length = 334 Score = 48.5 bits (114), Expect = 5e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +1 Query: 1 WNTTWGDSGYIKMRRDFNNMCGIATAASFPLV 96 W WG +GY+K+ +D NN CGIATAAS+P V Sbjct: 303 WGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,246,103 Number of Sequences: 369166 Number of extensions: 331772 Number of successful extensions: 897 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 68,354,980 effective HSP length: 39 effective length of database: 61,150,315 effective search space used: 1712208820 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)