Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_F16 (397 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q95135|EAA3_BOVIN Excitatory amino acid transporter 3 (S... 72 4e-13 sp|P51906|EAA3_MOUSE Excitatory amino acid transporter 3 (S... 72 4e-13 sp|P31597|EAA3_RABIT Excitatory amino acid transporter 3 (S... 72 5e-13 sp|P51907|EAA3_RAT Excitatory amino acid transporter 3 (Sod... 71 9e-13 sp|P43005|EAA3_HUMAN Excitatory amino acid transporter 3 (S... 70 2e-12 sp|P43004|EAA2_HUMAN Excitatory amino acid transporter 2 (S... 67 1e-11 sp|P43006|EAA2_MOUSE Excitatory amino acid transporter 2 (S... 67 1e-11 sp|P31596|EAA2_RAT Excitatory amino acid transporter 2 (Sod... 67 1e-11 sp|O57321|EAA1_AMBTI Excitatory amino acid transporter 1 (S... 66 3e-11 sp|Q10901|EAA1_CAEEL Excitatory amino acid transporter (Sod... 65 5e-11
>sp|Q95135|EAA3_BOVIN Excitatory amino acid transporter 3 (Sodium-dependent glutamate/aspartate transporter 3) (Excitatory amino-acid carrier 1) (Renal high affinity glutamate transporter EAAC1) Length = 524 Score = 72.0 bits (175), Expect = 4e-13 Identities = 37/64 (57%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAITTGNENEMV---TLDQNE 171 D+TLI+AVDWLLDR RT +NVLGDAFG GIV+ L KKELE + +E +V TL+ Sbjct: 432 DVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFTLESTA 491 Query: 172 SQNE 183 NE Sbjct: 492 LDNE 495
>sp|P51906|EAA3_MOUSE Excitatory amino acid transporter 3 (Sodium-dependent glutamate/aspartate transporter 3) (Excitatory amino-acid carrier 1) Length = 523 Score = 72.0 bits (175), Expect = 4e-13 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 8/70 (11%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAITTGNENEMV--------T 156 D+TLI+AVDWLLDR RT +NVLGDAFG GIV+ L KKELE + +E +V T Sbjct: 431 DVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEPTT 490 Query: 157 LDQNESQNER 186 LD +S ++ Sbjct: 491 LDNEDSDTKK 500
>sp|P31597|EAA3_RABIT Excitatory amino acid transporter 3 (Sodium-dependent glutamate/aspartate transporter 3) (Excitatory amino-acid carrier 1) Length = 524 Score = 71.6 bits (174), Expect = 5e-13 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 8/70 (11%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAITTGNENEMV--------T 156 D+TLI+AVDWLLDR RT +NVLGDAFG GIV+ L KKELE + +E +V T Sbjct: 432 DVTLIIAVDWLLDRFRTVVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALESAT 491 Query: 157 LDQNESQNER 186 LD +S ++ Sbjct: 492 LDNEDSDTKK 501
>sp|P51907|EAA3_RAT Excitatory amino acid transporter 3 (Sodium-dependent glutamate/aspartate transporter 3) (Excitatory amino-acid carrier 1) Length = 523 Score = 70.9 bits (172), Expect = 9e-13 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAITTGNENEMV 153 D+TLI+AVDWLLDR RT +NVLGDAFG GIV+ L KKELE + +E +V Sbjct: 431 DVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQVDVSSEVNIV 481
>sp|P43005|EAA3_HUMAN Excitatory amino acid transporter 3 (Sodium-dependent glutamate/aspartate transporter 3) (Excitatory amino-acid carrier 1) (Neuronal and epithelial glutamate transporter) Length = 524 Score = 70.1 bits (170), Expect = 2e-12 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAITTGNENEMV 153 D+TLI+AVDWLLDR RT +NVLGDAFG GIV+ L KKELE + +E +V Sbjct: 432 DVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIV 482
>sp|P43004|EAA2_HUMAN Excitatory amino acid transporter 2 (Sodium-dependent glutamate/aspartate transporter 2) Length = 574 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAI 126 DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K EL+ I Sbjct: 463 DISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTI 504
>sp|P43006|EAA2_MOUSE Excitatory amino acid transporter 2 (Sodium-dependent glutamate/aspartate transporter 2) (GLT-1) Length = 572 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAI 126 DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K EL+ I Sbjct: 462 DISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTI 503
>sp|P31596|EAA2_RAT Excitatory amino acid transporter 2 (Sodium-dependent glutamate/aspartate transporter 2) (GLUT-R) (GLT-1) Length = 573 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEAI 126 DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K EL+ I Sbjct: 462 DISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTI 503
>sp|O57321|EAA1_AMBTI Excitatory amino acid transporter 1 (SEAAT1) Length = 543 Score = 65.9 bits (159), Expect = 3e-11 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 6/69 (8%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEA--ITTGN----ENEMVTLD 162 DITLI+AVDW LDR+RT+ NVLGD+ GAGIV+HL + EL++ GN ENEM Sbjct: 465 DITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELQSGDAEMGNSVIEENEMKKPY 524 Query: 163 QNESQNERL 189 Q SQ L Sbjct: 525 QLVSQENEL 533
>sp|Q10901|EAA1_CAEEL Excitatory amino acid transporter (Sodium-dependent glutamate/ aspartate transporter) Length = 503 Score = 65.1 bits (157), Expect = 5e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 1 DITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKELEA 123 D++LI+AVDWLLDR+RTSINVLGDA GAGIV H K +L+A Sbjct: 426 DVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLDA 466
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,817,896 Number of Sequences: 369166 Number of extensions: 448454 Number of successful extensions: 1196 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 68,354,980 effective HSP length: 97 effective length of database: 50,435,685 effective search space used: 1714813290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)