Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_E05 (552 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P05877|ENV_HV1MN Envelope polyprotein GP160 precursor [C... 32 1.0 sp|Q8F435|UVRA_LEPIN UvrABC system protein A (UvrA protein)... 29 6.7
>sp|P05877|ENV_HV1MN Envelope polyprotein GP160 precursor [Contains: Exterior membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 856 Score = 32.0 bits (71), Expect = 1.0 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 297 VDISWI*CSGYNYRDIYSCGCRFIEKLSRLFWNILRNWYIHDYIWS 434 VD+ + Y++RD+ R +E L R W +L+ W+ WS Sbjct: 759 VDLRSLFLFSYHHRDLLLIAARIVELLGRRGWEVLKYWWNLLQYWS 804
>sp|Q8F435|UVRA_LEPIN UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A) sp|Q72RM8|UVRA_LEPIC UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A) Length = 948 Score = 29.3 bits (64), Expect = 6.7 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 311 PADIDSHINAVIKKFLSGRLVK*KLDAPAAIR 216 PA++ H N++ K+LSGRL K+ PA +R Sbjct: 576 PAEVSKHKNSLTGKYLSGRL---KVPIPAKLR 604
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,471,806 Number of Sequences: 369166 Number of extensions: 1111048 Number of successful extensions: 2744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2744 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3882260660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)