Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_H06 (235 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B 33 0.27 sp|P58955|GR36A_DROME Putative gustatory receptor 36a 29 3.9 sp|Q9H0J9|ZCC1_HUMAN Zinc finger CCCH type domain containin... 28 8.7 sp|P27398|CAND_DROME Calpain D (Calcium-activated neutral p... 28 8.7
>sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B Length = 89 Score = 32.7 bits (73), Expect = 0.27 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 91 YSCSSNVQWFIRACVSSNNSIMW 23 Y S+ + W IR+CV++N S+MW Sbjct: 16 YDASAQMGWVIRSCVATNKSMMW 38
>sp|P58955|GR36A_DROME Putative gustatory receptor 36a Length = 391 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 152 HMA*MHNYVKMLLFQRTYHHLLLLEQRTVVHKS 54 +MA +Y+ ++LF R Y+HLL E R +H+S Sbjct: 173 NMAISQHYL-VILFVRAYYHLLKTEVRQAIHES 204
>sp|Q9H0J9|ZCC1_HUMAN Zinc finger CCCH type domain containing protein 1 Length = 701 Score = 27.7 bits (60), Expect = 8.7 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 8 GNGAVPHNAVVGGHTSSYEPLYVARARV-SGDMCVGKVASSHNCAFMPYG 154 G A P V+ PL + RA S CVG A H C FM YG Sbjct: 57 GAAAAPERVVLAA-----SPLRLCRAHQGSKPGCVGLCAQLHLCRFMVYG 101
>sp|P27398|CAND_DROME Calpain D (Calcium-activated neutral proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 76 NVQWFIRACVSSNNSIMWYCPI 11 N +W AC + N+S+ W+C I Sbjct: 136 NRRWVCHACGTDNSSVTWHCLI 157
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,112,643 Number of Sequences: 369166 Number of extensions: 568625 Number of successful extensions: 1458 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 68,354,980 effective HSP length: 48 effective length of database: 59,487,700 effective search space used: 1725143300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)