Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_G08 (333 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P36168|YK76_YEAST Hypothetical 137.5 kDa protein in MPL1... 28 6.6 sp|Q00362|2ABA_YEAST Protein phosphatase PP2A regulatory su... 28 6.6 sp|Q16663|CCL15_HUMAN Small inducible cytokine A15 precurso... 28 8.7 sp|Q11181|YPC4_CAEEL Hypothetical protein C05D10.4 in chrom... 28 8.7
>sp|P36168|YK76_YEAST Hypothetical 137.5 kDa protein in MPL1-PPC1 intergenic region Length = 1195 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 258 HDLKFEYVHPLSTCARPTEPVRPTLSAFL*VIL*TN*NSLKC 133 HDL E+ + + T RP P T A+L + N SLKC Sbjct: 652 HDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFLNMTSLKC 693
>sp|Q00362|2ABA_YEAST Protein phosphatase PP2A regulatory subunit B (PR55) (Cell division control protein 55) Length = 526 Score = 28.1 bits (61), Expect = 6.6 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = -1 Query: 327 KVLLDSFDNKIDCTTQFMPAFVIHDLKFEYVHPLSTCARPTEP--VRPTLSAFL*VIL*T 154 +V+L N C +F+ F HD +F+Y+ L + E +RPT + +L T Sbjct: 48 RVVLFERSNSRHCEYKFLTEFQSHDAEFDYLKSLEIEEKINEIKWLRPTQRSHF--LLST 105 Query: 153 N*NSLKCFKNFK 118 N ++K +K ++ Sbjct: 106 NDKTIKLWKVYE 117
>sp|Q16663|CCL15_HUMAN Small inducible cytokine A15 precursor (CCL15) (Macrophage inflammatory protein 5) (MIP-5) (Chemokine CC-2) (HCC-2) (NCC-3) (MIP-1 delta) (Leukotactin-1) (LKN-1) (Mrp-2b) Length = 113 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 330 NKVLLDSFDNKIDCTTQFMPAFVIHDLKFEYVHPLSTCARP 208 N V+L+SF DC T ++ + L Y S C++P Sbjct: 40 NPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP 80
>sp|Q11181|YPC4_CAEEL Hypothetical protein C05D10.4 in chromosome III Length = 597 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Frame = +2 Query: 8 LSHTLSGR*SVFGKIHKK-----GIYRFKDINKNRYREIEQ 115 +SH SGR S+F K KK G + F+D NK+ I + Sbjct: 184 MSHDTSGRGSIFSKSSKKPLFFMGNWTFRDRNKSARPSISE 224
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,543,977 Number of Sequences: 369166 Number of extensions: 607251 Number of successful extensions: 1300 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1300 length of database: 68,354,980 effective HSP length: 78 effective length of database: 53,945,650 effective search space used: 1726260800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)