Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_F05 (631 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P15545|COX2_STRPU Cytochrome c oxidase subunit 2 (Cytoch... 54 4e-07 sp|O79673|COX2_PELSU Cytochrome c oxidase subunit 2 (Cytoch... 53 7e-07 sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytoch... 52 1e-06 sp|P05490|COX2_OENBE Cytochrome c oxidase subunit 2 (Cytoch... 52 1e-06 sp|P50689|COX2_GEOCP Cytochrome c oxidase subunit 2 (Cytoch... 52 1e-06 sp|O03891|COX2_DRONO Cytochrome c oxidase subunit 2 (Cytoch... 52 1e-06 sp|P50666|COX2_CAIMO Cytochrome c oxidase subunit 2 (Cytoch... 52 1e-06 sp|Q00528|COX2_PHOVI Cytochrome c oxidase subunit 2 (Cytoch... 52 2e-06 sp|P38596|COX2_HALGR Cytochrome c oxidase subunit 2 (Cytoch... 52 2e-06 sp|P98043|COX2_TARBA Cytochrome c oxidase subunit 2 (Cytoch... 52 2e-06
>sp|P15545|COX2_STRPU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 229 Score = 53.5 bits (127), Expect = 4e-07 Identities = 21/39 (53%), Positives = 29/39 (74%) Frame = +1 Query: 7 SGVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSIL 123 +GV+YGQCSE+CG NHS+MP V+ +P N++ N T L Sbjct: 189 TGVFYGQCSEICGANHSFMPIVIESVPFNTFENWVTQYL 227
>sp|O79673|COX2_PELSU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 229 Score = 52.8 bits (125), Expect = 7e-07 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +1 Query: 1 MSSGVYYGQCSEVCGLNHSYMPFVVTVLPENSY 99 M +G++YGQCSE+CG NHS+MP VV LP N + Sbjct: 187 MQAGIFYGQCSEICGANHSFMPVVVESLPMNHF 219
>sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 229 Score = 52.0 bits (123), Expect = 1e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSIL 123 GV+YGQCSE+CG NHS+MP VV +P + N +S+L Sbjct: 190 GVFYGQCSEICGANHSFMPIVVEAVPLTDFENWSSSML 227
>sp|P05490|COX2_OENBE Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 258 Score = 52.0 bits (123), Expect = 1e-06 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSILSP 129 GVYYGQCSE+CG NH++MP V+ + Y N +++ P Sbjct: 216 GVYYGQCSEICGTNHAFMPIVIEAVSATDYTNWVSNLFIP 255
>sp|P50689|COX2_GEOCP Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 52.0 bits (123), Expect = 1e-06 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSI 120 G++YGQCSE+CG NHS+MP V+ ++P S+ N TS+ Sbjct: 190 GLFYGQCSEICGSNHSFMPIVIEMVPLKSFENWTTSM 226
>sp|O03891|COX2_DRONO Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 199 Score = 52.0 bits (123), Expect = 1e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSILSPSDPI 141 G++YGQCSE+CG NHSYMP VV P + N ++S+LS S + Sbjct: 157 GIFYGQCSEICGANHSYMPIVVESTPLTHFEN-WSSLLSASSSL 199
>sp|P50666|COX2_CAIMO Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 228 Score = 52.0 bits (123), Expect = 1e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSILSPS 132 GV+YGQCSE+CG NHSYMP VV P Y ++S+LS S Sbjct: 189 GVFYGQCSEICGANHSYMPIVVESTP-LPYFETWSSLLSAS 228
>sp|Q00528|COX2_PHOVI Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 51.6 bits (122), Expect = 2e-06 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = +1 Query: 1 MSSGVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSIL 123 M G+YYGQCSE+CG NHS+MP V+ ++P + + TS+L Sbjct: 187 MRPGLYYGQCSEICGSNHSFMPIVLELVPLSHFEKWSTSML 227
>sp|P38596|COX2_HALGR Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 51.6 bits (122), Expect = 2e-06 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = +1 Query: 1 MSSGVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSIL 123 M G+YYGQCSE+CG NHS+MP V+ ++P + + TS+L Sbjct: 187 MRPGLYYGQCSEICGSNHSFMPIVLELVPLSHFEKWSTSML 227
>sp|P98043|COX2_TARBA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 51.6 bits (122), Expect = 2e-06 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = +1 Query: 10 GVYYGQCSEVCGLNHSYMPFVVTVLPENSYLNLFTSIL 123 G+YYGQCSE+CG NHS+MP V+ ++P + N TS++ Sbjct: 190 GLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSTSMI 227
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.313 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,513,146 Number of Sequences: 369166 Number of extensions: 446262 Number of successful extensions: 1397 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1397 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5023626210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)