Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_D10 (411 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q6BSY1|MAD1_DEBHA Spindle assembly checkpoint component ... 32 0.38 sp|Q6BZE9|SNX4_DEBHA Sorting nexin-4 (Autophagy-related pro... 31 0.84 sp|P95949|HELX_SULSO Putative ATP-dependent helicase SSO0112 30 2.4 sp|Q6P5D4|CEP4_MOUSE Centrosomal protein 4 (Centrosomal pro... 29 3.2 sp|Q8XV02|YU30_RALSO Hypothetical UPF0192 protein RSc3030 p... 28 7.1 sp|Q00107|VG67_ICHV1 Hypothetical gene 67 protein 28 7.1
>sp|Q6BSY1|MAD1_DEBHA Spindle assembly checkpoint component MAD1 (Mitotic arrest deficient protein 1) Length = 669 Score = 32.3 bits (72), Expect = 0.38 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 94 EYSTKYTHEDSL---CLVEIQTGDEDITNQQDHVLNQQYYLQKKFRHFCILTDNLSSDIE 264 E +KY + + + +Q +DIT + D + + YL F+ FC + + SD+E Sbjct: 84 ELQSKYDNSQQINGKTVESLQVQLKDITERYDELKEEHEYLNSDFKKFCRDNNQVKSDLE 143 Query: 265 LDI 273 I Sbjct: 144 FHI 146
>sp|Q6BZE9|SNX4_DEBHA Sorting nexin-4 (Autophagy-related protein 24) Length = 582 Score = 31.2 bits (69), Expect = 0.84 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +1 Query: 49 DTDVANLKEIQSILTEYSTKYTHEDSLCLVEIQTGDEDIT-----NQQDHVLNQ 195 D D L E ++I + TK +E + L+ +TGDE+I+ N+ DH++ + Sbjct: 46 DNDTTKLNEPENIQEDDETKDDNEPTDSLILSKTGDENISNIESQNEGDHIVGE 99
>sp|P95949|HELX_SULSO Putative ATP-dependent helicase SSO0112 Length = 875 Score = 29.6 bits (65), Expect = 2.4 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 3/104 (2%) Frame = +1 Query: 1 GSVHKHFCAQISENSPDTDVANLKEIQSILTEY--STKYTHEDSLCLVEIQTGDEDITNQ 174 G H IS+ A++ IL +Y + D+L L+EI +E I N Sbjct: 599 GVTHNEIIESISKEYEIDKHASMSIYTYILEQYLFTNGKVPSDNLILIEIYDDEEGIRNY 658 Query: 175 QDHVLNQQYYLQKKFRHFC-ILTDNLSSDIELDIGFLSTNGVAV 303 H L + L R F ++++ L +D+ + + + NG A+ Sbjct: 659 IFHALYGRRALDALSRAFAYVVSEELDTDVRVSV---TDNGFAL 699
>sp|Q6P5D4|CEP4_MOUSE Centrosomal protein 4 (Centrosomal protein of 135 kDa) (Cep135 protein) Length = 1140 Score = 29.3 bits (64), Expect = 3.2 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 3/87 (3%) Frame = +1 Query: 13 KHFCAQISENSPDTDVANLKEIQSILTEYSTKYTHEDSLCLVEIQTGDEDITNQQDHVLN 192 K F + ++ + DT++ LKE ++ T + E S+ ++ D N + + N Sbjct: 1043 KEFQSHLTSHEKDTEIQLLKEKLNLSESKLTTQSRETSMLRTKVTQLQTDYDNLKRQMSN 1102 Query: 193 QQYYLQK---KFRHFCILTDNLSSDIE 264 ++Y ++ + R + T LSS ++ Sbjct: 1103 EKYERERAIQEMRRLGLPTSPLSSTLK 1129
>sp|Q8XV02|YU30_RALSO Hypothetical UPF0192 protein RSc3030 precursor Length = 1582 Score = 28.1 bits (61), Expect = 7.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 202 YLQKKFRHFCILTDNLSSDIELDIGFLSTNGVAVLSLNTFLTNKTGKYIKKTLPS 366 ++ + FR T + DI+LD+ + G V + T L+ +TG + TLPS Sbjct: 353 FIGRNFRSATESTAPAAGDIKLDV--IDPTGAPVATTTTRLSGETGADARFTLPS 405
>sp|Q00107|VG67_ICHV1 Hypothetical gene 67 protein Length = 1556 Score = 28.1 bits (61), Expect = 7.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 72 GDPVYFDRILHEIHT*RFLVLGGNPNRRRG 161 G P+ DR+L++I R L +G RRG Sbjct: 1445 GTPIVMDRVLYDISIDRILTVGERDGDRRG 1474
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,449,654 Number of Sequences: 369166 Number of extensions: 879096 Number of successful extensions: 2733 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2732 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 1852449955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)