Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_A09 (638 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P22224|SEC15_YEAST Exocyst complex component SEC15 31 2.3 sp|Q9ZLL4|MUTS2_HELPJ MutS2 protein 30 6.8
>sp|P22224|SEC15_YEAST Exocyst complex component SEC15 Length = 910 Score = 31.2 bits (69), Expect = 2.3 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 9/81 (11%) Frame = -1 Query: 551 NKAVIKSSKVQIKKNIFKKVTSTSCKI*QVISVIHLQIKARYKI---------QNIFSLQ 399 N+ ++K K I K++ + I +V+ ++ L K + I QN+ SL+ Sbjct: 143 NELIVKKQMYVNNKKISLKISEATILITKVVRILELSSKCQELITERKFFKVLQNLDSLE 202 Query: 398 SLDAKELNNSHFQT*VNILHS 336 L +E N +FQ + I +S Sbjct: 203 KLYLQEFKNYNFQFLIEIYNS 223
>sp|Q9ZLL4|MUTS2_HELPJ MutS2 protein Length = 762 Score = 29.6 bits (65), Expect = 6.8 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -1 Query: 572 NKHTKKFNKAVIKSSKVQIKKNIFKKVTSTSCKI*QVISVIHLQIKARYKIQNIFSLQSL 393 +K T +K + K+S++ K T +I Q+I+ + KARYK +++ +Q L Sbjct: 586 SKDTSSMHKEIHKASEILNKHK-------TDQEIPQIITSFQINEKARYKNESVLVIQIL 638 Query: 392 D 390 D Sbjct: 639 D 639
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,457,841 Number of Sequences: 369166 Number of extensions: 1417078 Number of successful extensions: 3080 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3080 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5169945420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)