Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_O06 (408 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P23785|GRN_RAT Granulins precursor [Contains: Acrogranin... 39 0.005 sp|P28799|GRN_HUMAN Granulins precursor (Proepithelin) (PEP... 37 0.012 sp|P28798|GRN_MOUSE Granulins precursor (Acrogranin) (Proep... 37 0.020 sp|P28797|GRN_CAVPO Granulins precursor (Proepithelin) (PEP... 36 0.034 sp|P80930|ENA1_HORSE Antimicrobial peptide eNAP-1 35 0.045 sp|P34504|YMV2_CAEEL Hypothetical protein K04H4.2 precursor 33 0.22 sp|P15265|MCSP_MOUSE Sperm mitochondrial associated cystein... 30 1.4 sp|P07987|GUX2_TRIRE Exoglucanase II precursor (Exocellobio... 30 1.4 sp|P33539|RPOP_AGABT Probable DNA-directed RNA polymerase 30 1.4 sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 29 4.2
>sp|P23785|GRN_RAT Granulins precursor [Contains: Acrogranin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] Length = 588 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +1 Query: 175 FKSSLWNRWCPGNYYCHSSQTCCAPGR----CCPYPYVNCCPGG 294 F S + N C ++CH +Q+CC + CCPY CC G Sbjct: 507 FGSKVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDG 550
Score = 33.5 bits (75), Expect = 0.17 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +1 Query: 202 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 285 CPG+ + C S TCC CCP P +CC Sbjct: 125 CPGSQFECPDSATCCIMIDGSWGCCPMPQASCC 157
>sp|P28799|GRN_HUMAN Granulins precursor (Proepithelin) (PEPI) [Contains: Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] Length = 593 Score = 37.4 bits (85), Expect = 0.012 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +1 Query: 202 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 285 C ++CH +QTCC R CCPY CC Sbjct: 521 CGEGHFCHDNQTCCRDNRQGWACCPYRQGVCC 552
Score = 29.6 bits (65), Expect = 2.5 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 12/45 (26%) Frame = +1 Query: 202 CPGNYY-CHSSQTCCA----PGRCCPYPY-------VNCCPGGLF 300 CP + + C TCC CCP P V+CCP G F Sbjct: 126 CPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAF 170
Score = 28.9 bits (63), Expect = 4.2 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 4/32 (12%) Frame = +1 Query: 202 CPGNYYCHSSQTCC----APGRCCPYPYVNCC 285 C C SS TCC CCP P CC Sbjct: 366 CDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCC 397
>sp|P28798|GRN_MOUSE Granulins precursor (Acrogranin) (Proepithelin) (PEPI) (PC cell-derived growth factor) (PCDGF) [Contains: Granulin 1; Granulin 2; Granulin 3; Granulin 4; Granulin 5; Granulin 6; Granulin 7] Length = 589 Score = 36.6 bits (83), Expect = 0.020 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 11/42 (26%) Frame = +1 Query: 202 CPGNYYCHSSQTCCAPG----RCCPY-------PYVNCCPGG 294 C ++CH +QTCC CCPY +CCPGG Sbjct: 517 CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGG 558
Score = 33.5 bits (75), Expect = 0.17 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +1 Query: 202 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 285 CPG+ + C S TCC CCP P +CC Sbjct: 125 CPGSQFECPDSATCCIMVDGSWGCCPMPQASCC 157
>sp|P28797|GRN_CAVPO Granulins precursor (Proepithelin) (PEPI) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 591 Score = 35.8 bits (81), Expect = 0.034 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 202 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 285 C ++CH QTCC R CCP+ CC Sbjct: 518 CGDRHFCHDEQTCCRDSRGGWACCPFHQGVCC 549
Score = 33.5 bits (75), Expect = 0.17 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 11/46 (23%) Frame = +1 Query: 184 SLWNRWCPGNYYCHSSQTCCA--PGR--CCPYP-------YVNCCP 288 ++W+ C C QTCC G+ CCP+P +V+CCP Sbjct: 277 TVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCP 322
Score = 33.1 bits (74), Expect = 0.22 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +1 Query: 202 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 285 CPG + C S TCC CCP P +CC Sbjct: 112 CPGGEFECPDSSTCCHMLDGSWGCCPMPQASCC 144
>sp|P80930|ENA1_HORSE Antimicrobial peptide eNAP-1 Length = 46 Score = 35.4 bits (80), Expect = 0.045 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 202 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 285 C ++CH QTCC + CCPY CC Sbjct: 4 CGEGHFCHDXQTCCRASQGGXACCPYSQGVCC 35
>sp|P34504|YMV2_CAEEL Hypothetical protein K04H4.2 precursor Length = 967 Score = 33.1 bits (74), Expect = 0.22 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 211 NYYCHSSQTCCAPGRCCPYPYVNCCPGG 294 +YYC S TC CCP +N CP G Sbjct: 550 SYYCGSGYTCTTGNICCP---INSCPNG 574
>sp|P15265|MCSP_MOUSE Sperm mitochondrial associated cysteine-rich protein Length = 143 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 202 CPGNYYCHSSQTCCAPGRCCPYPYVNCCP 288 CP C CC CCP P CCP Sbjct: 21 CPPKPCCPQKPPCCPKSPCCP-PKSPCCP 48
>sp|P07987|GUX2_TRIRE Exoglucanase II precursor (Exocellobiohydrolase II) (CBHII) (1,4-beta-cellobiohydrolase) Length = 471 Score = 30.4 bits (67), Expect = 1.4 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 181 SSLWNRWCPGNYYCHSSQTCCAPGRCCPYP---YVNCCPG 291 SS+W + C G + S TCCA G C Y Y C PG Sbjct: 28 SSVWGQ-CGGQNW--SGPTCCASGSTCVYSNDYYSQCLPG 64
>sp|P33539|RPOP_AGABT Probable DNA-directed RNA polymerase Length = 1102 Score = 30.4 bits (67), Expect = 1.4 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 8/60 (13%) Frame = -3 Query: 364 SLSIIICNTVHIHNNNI-----HFDSKII--HQDSNLRKGMDNIYQVHNKFVKSD-NSNF 209 S+++ + N + NNNI +K+I +++S + K + Y+VHNKF+K + N+NF Sbjct: 152 SIAVTVKNKILELNNNIAEVLLSIKNKVIVLNKESVVAKVEEINYEVHNKFIKGNGNTNF 211
>sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 Length = 1111 Score = 28.9 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 283 SNLRKGMDNIYQVHNKFVKSDNSNFLDTIDSI 188 S+ RK ++ IYQ H +F+K+ ++ +DSI Sbjct: 644 SHYRKDLNEIYQSHQQFLKNLQNDIKSCLDSI 675
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,214,694 Number of Sequences: 369166 Number of extensions: 587982 Number of successful extensions: 1886 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1864 length of database: 68,354,980 effective HSP length: 98 effective length of database: 50,250,950 effective search space used: 1859285150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)