Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_L04 (629 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9KNF3|MALT_VIBCH HTH-type transcriptional regulator mal... 31 3.0 sp|Q42858|PAL2_IPOBA Phenylalanine ammonia-lyase 30 3.9
>sp|Q9KNF3|MALT_VIBCH HTH-type transcriptional regulator malT (ATP-dependent transcriptional activator malT) Length = 902 Score = 30.8 bits (68), Expect = 3.0 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -1 Query: 554 QEHRTSVRTRSPSTYRPDKACNQ-SMIKWTN 465 +E+ T +R S+ RPDKACN S ++W N Sbjct: 666 KENSTEIRQWLQSSTRPDKACNHFSQLQWRN 696
>sp|Q42858|PAL2_IPOBA Phenylalanine ammonia-lyase Length = 708 Score = 30.4 bits (67), Expect = 3.9 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 444 ISPALVNVDHKHNIVTETRQSMAGWHGDDECKEIINERVEGL*KSINQSN 295 + AL N +H+ N+ T Q +A + +DE K ++ + VEG +I N Sbjct: 590 VDHALQNGEHEKNVSTSIFQKIAAF--EDELKAVLPKEVEGARSAIENGN 637
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,289,722 Number of Sequences: 369166 Number of extensions: 1096532 Number of successful extensions: 2706 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2706 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5023626210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)