Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_L03 (671 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q41046|PHY_PINSY Phytochrome 32 2.0 sp|Q49YZ1|AGRB_STAS1 Accessory gene regulator protein B 31 2.6
>sp|Q41046|PHY_PINSY Phytochrome Length = 1131 Score = 31.6 bits (70), Expect = 2.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 614 NSNHTKKQSTPTNIKYTKTHTKTQCTKGTIKKKY 513 NS HT+ QST +N + + T+T T K T +Y Sbjct: 4 NSRHTQSQSTGSNNRRSSTNTNTTTNKATAMAQY 37
>sp|Q49YZ1|AGRB_STAS1 Accessory gene regulator protein B Length = 189 Score = 31.2 bits (69), Expect = 2.6 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Frame = -1 Query: 641 KLFTIKI*QNSNHTKKQSTPTNIKYTKTHTKTQCTKGTIKKK---YMLPFPLENFVETLT 471 K KI + ++++ I+Y K Q K Y + F+ TLT Sbjct: 3 KFIDAKIDNFAKQLQQRNNLDRIEYLKMRLGMQVVVNNFFKTIVIYGVSLLCHMFLYTLT 62 Query: 470 ENLTFKKYIRHMSNTYENTNTLSCYILSYFF 378 +LTF +IRH ++ N+L CYI S + Sbjct: 63 VHLTFF-FIRHFAHGAHAKNSLLCYIQSVIY 92
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,523,310 Number of Sequences: 369166 Number of extensions: 857402 Number of successful extensions: 2488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2482 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 5636246860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)