Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_K01 (888 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P57220|PRIA_BUCAI Primosomal protein N' (ATP-dependent h... 31 5.3 sp|Q47318|IUCC_ECOLI Aerobactin siderophore biosynthesis pr... 30 6.9 sp|P07149|FAS1_YEAST Fatty acid synthase beta subunit [Incl... 30 9.0 sp|P54418|PPCK_BACSU Phosphoenolpyruvate carboxykinase [ATP... 30 9.0 sp|O04887|PME2_CITSI Pectinesterase-2 precursor (Pectin met... 30 9.0
>sp|P57220|PRIA_BUCAI Primosomal protein N' (ATP-dependent helicase priA) (Replication factor Y) Length = 726 Score = 30.8 bits (68), Expect = 5.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 404 IMKLEIHGYREQLLILKNSPVSELCKENLNFIIN 505 I+ E+ Y +ILK + ELCK NLN+ I+ Sbjct: 149 ILSTELKKYNISKIILKKLEIQELCKVNLNYKIS 182
>sp|Q47318|IUCC_ECOLI Aerobactin siderophore biosynthesis protein iucC Length = 580 Score = 30.4 bits (67), Expect = 6.9 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 337 YAGTLEEFFEITW---KNRHLLPLVDNEVGDTWIQGTASDPKKFARFRAMQRE 486 YA F + W K H++ DNE+ + A DP++FARF + +E Sbjct: 156 YAPEYANTFRLHWLAVKREHMIWRCDNEMDIHQLLTAAMDPQEFARFSQVWQE 208
>sp|P07149|FAS1_YEAST Fatty acid synthase beta subunit [Includes: 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase ; Enoyl-[acyl-carrier-protein] reductase [NADH] ; [Acyl-carrier-protein] acetyltransferase ; [Acyl-carrier-protein] malonyltransferase ; S-acyl fatty acid synthase thioesterase ] Length = 2051 Score = 30.0 bits (66), Expect = 9.0 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 23/78 (29%) Frame = +1 Query: 265 PPQSIQEVLNAYEVVRGRYINAH-----------------IYAGTLEEFFEI------TW 375 P ++I++V NAY R +++NA + L+ FEI W Sbjct: 976 PDEAIEKVFNAYPAAREQFLNAQDIDHFLSMCQNPMQKPVPFVPVLDRRFEIFFKKDSLW 1035 Query: 376 KNRHLLPLVDNEVGDTWI 429 ++ HL +VD +V T I Sbjct: 1036 QSEHLEAVVDQDVQRTCI 1053
>sp|P54418|PPCK_BACSU Phosphoenolpyruvate carboxykinase [ATP] (PEP carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 527 Score = 30.0 bits (66), Expect = 9.0 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 705 NILGPNHTLTLSILEEFKKMENFDALKFKKNFKNSIHPDFVLQ 833 +IL P +T T EE+K+ + A +FK+NFK H D + Q Sbjct: 481 HILQPENTWTNK--EEYKEKAVYLANEFKENFKKFAHTDAIAQ 521
>sp|O04887|PME2_CITSI Pectinesterase-2 precursor (Pectin methylesterase) (PE) Length = 510 Score = 30.0 bits (66), Expect = 9.0 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +1 Query: 253 DNTGPPQSIQEVLNAYEVVRGRYINAHIYAGTLEEFFEITWKNRHLLPLVDNEVGDTWIQ 432 D +G ++IQE + A G +I AGT E E+ KN + V + +G T I Sbjct: 208 DGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKN---IMFVGDGIGKTIIT 264 Query: 433 GTAS 444 G+ S Sbjct: 265 GSKS 268
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,027,607 Number of Sequences: 369166 Number of extensions: 2072360 Number of successful extensions: 4687 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4686 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 8886314050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)