Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_I10 (359 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P23785|GRN_RAT Granulins precursor [Contains: Acrogranin... 39 0.004 sp|P28799|GRN_HUMAN Granulins precursor (Proepithelin) (PEP... 37 0.011 sp|P28798|GRN_MOUSE Granulins precursor (Acrogranin) (Proep... 37 0.018 sp|P28797|GRN_CAVPO Granulins precursor (Proepithelin) (PEP... 36 0.031 sp|P80930|ENA1_HORSE Antimicrobial peptide eNAP-1 35 0.040 sp|P34504|YMV2_CAEEL Hypothetical protein K04H4.2 precursor 33 0.20 sp|P15265|MCSP_MOUSE Sperm mitochondrial associated cystein... 30 1.3 sp|P07987|GUX2_TRIRE Exoglucanase II precursor (Exocellobio... 30 1.3 sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 (FYVE ... 30 1.7 sp|Q8FDN6|MASZ_ECOL6 Malate synthase G 29 2.9
>sp|P23785|GRN_RAT Granulins precursor [Contains: Acrogranin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] Length = 588 Score = 38.9 bits (89), Expect = 0.004 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 119 SFKSSLWNRWCPGNYYCHSSQTCCAPGR----CCPYPYVNCCPGG 241 +F S + N C ++CH +Q+CC + CCPY CC G Sbjct: 506 TFGSKVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDG 550
Score = 33.5 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +2 Query: 149 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 232 CPG+ + C S TCC CCP P +CC Sbjct: 125 CPGSQFECPDSATCCIMIDGSWGCCPMPQASCC 157
Score = 30.0 bits (66), Expect = 1.7 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +2 Query: 71 PQVVKVKASKSIVTKSSFKSSLWNRWCPGNYYCHSSQTCCAPGR----CCPYPYVNCC 232 P + KV AS S+ K+ + C C S+ TCC CCP P CC Sbjct: 340 PWMKKVTASLSLPDPQILKNDVP---CDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCC 394
>sp|P28799|GRN_HUMAN Granulins precursor (Proepithelin) (PEPI) [Contains: Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] Length = 593 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +2 Query: 149 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 232 C ++CH +QTCC R CCPY CC Sbjct: 521 CGEGHFCHDNQTCCRDNRQGWACCPYRQGVCC 552
Score = 29.6 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 12/45 (26%) Frame = +2 Query: 149 CPGNYY-CHSSQTCCA----PGRCCPYPY-------VNCCPGGLF 247 CP + + C TCC CCP P V+CCP G F Sbjct: 126 CPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAF 170
Score = 28.9 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 4/32 (12%) Frame = +2 Query: 149 CPGNYYCHSSQTCC----APGRCCPYPYVNCC 232 C C SS TCC CCP P CC Sbjct: 366 CDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCC 397
>sp|P28798|GRN_MOUSE Granulins precursor (Acrogranin) (Proepithelin) (PEPI) (PC cell-derived growth factor) (PCDGF) [Contains: Granulin 1; Granulin 2; Granulin 3; Granulin 4; Granulin 5; Granulin 6; Granulin 7] Length = 589 Score = 36.6 bits (83), Expect = 0.018 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 11/42 (26%) Frame = +2 Query: 149 CPGNYYCHSSQTCCAPG----RCCPY-------PYVNCCPGG 241 C ++CH +QTCC CCPY +CCPGG Sbjct: 517 CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGG 558
Score = 33.5 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +2 Query: 149 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 232 CPG+ + C S TCC CCP P +CC Sbjct: 125 CPGSQFECPDSATCCIMVDGSWGCCPMPQASCC 157
>sp|P28797|GRN_CAVPO Granulins precursor (Proepithelin) (PEPI) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 591 Score = 35.8 bits (81), Expect = 0.031 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +2 Query: 149 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 232 C ++CH QTCC R CCP+ CC Sbjct: 518 CGDRHFCHDEQTCCRDSRGGWACCPFHQGVCC 549
Score = 34.3 bits (77), Expect = 0.090 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 11/58 (18%) Frame = +2 Query: 95 SKSIVTKSSFKSSLWNRWCPGNYYCHSSQTCCA--PGR--CCPYP-------YVNCCP 235 +K+++TK ++W+ C C QTCC G+ CCP+P +V+CCP Sbjct: 266 AKTLLTKLP-SWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCP 322
Score = 33.1 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +2 Query: 149 CPGNYY-CHSSQTCC----APGRCCPYPYVNCC 232 CPG + C S TCC CCP P +CC Sbjct: 112 CPGGEFECPDSSTCCHMLDGSWGCCPMPQASCC 144
>sp|P80930|ENA1_HORSE Antimicrobial peptide eNAP-1 Length = 46 Score = 35.4 bits (80), Expect = 0.040 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +2 Query: 149 CPGNYYCHSSQTCCAPGR----CCPYPYVNCC 232 C ++CH QTCC + CCPY CC Sbjct: 4 CGEGHFCHDXQTCCRASQGGXACCPYSQGVCC 35
>sp|P34504|YMV2_CAEEL Hypothetical protein K04H4.2 precursor Length = 967 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 158 NYYCHSSQTCCAPGRCCPYPYVNCCPGG 241 +YYC S TC CCP +N CP G Sbjct: 550 SYYCGSGYTCTTGNICCP---INSCPNG 574
>sp|P15265|MCSP_MOUSE Sperm mitochondrial associated cysteine-rich protein Length = 143 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 149 CPGNYYCHSSQTCCAPGRCCPYPYVNCCP 235 CP C CC CCP P CCP Sbjct: 21 CPPKPCCPQKPPCCPKSPCCP-PKSPCCP 48
>sp|P07987|GUX2_TRIRE Exoglucanase II precursor (Exocellobiohydrolase II) (CBHII) (1,4-beta-cellobiohydrolase) Length = 471 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 128 SSLWNRWCPGNYYCHSSQTCCAPGRCCPYP---YVNCCPG 238 SS+W + C G + S TCCA G C Y Y C PG Sbjct: 28 SSVWGQ-CGGQNW--SGPTCCASGSTCVYSNDYYSQCLPG 64
>sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 (FYVE domain-containing dual specificity protein phosphatase 1) (FYVE-DSP1) (Zinc finger FYVE domain containing protein 10) Length = 1198 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 320 IKRSLSIIICNSVHIHNNNIHFDSKIIHQDSNLRKGMDNICQVHNKFVKSDN-SNFLDTI 144 + R LS + C+S H+H+ N+H K +H S + Q + D S + DTI Sbjct: 970 LSRQLSAMSCSSAHLHSRNLH--HKWLHSHSGRPSATSSPDQPSRSHLDDDGMSVYTDTI 1027
>sp|Q8FDN6|MASZ_ECOL6 Malate synthase G Length = 723 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = -1 Query: 278 IHNNNIHFDSKIIHQDSNLRKGMDNICQVHNKFVKSDNSNFLDTIDSITMI 126 + NN +H + +I D+N R G D+ +++ V++ S LD DS+ + Sbjct: 231 LKNNGLHIELQI---DANGRIGKDDSAHINDVIVEAAISTILDCEDSVAAV 278
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,933,557 Number of Sequences: 369166 Number of extensions: 531981 Number of successful extensions: 2080 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2058 length of database: 68,354,980 effective HSP length: 87 effective length of database: 52,283,035 effective search space used: 1673057120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)