Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_H18 (520 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P24464|CP4A8_RAT Cytochrome P450 4A8 (CYPIVA8) (P450-KP1... 29 5.9 sp|P49953|WT1_SMIMA Wilms' tumor protein 29 7.7
>sp|P24464|CP4A8_RAT Cytochrome P450 4A8 (CYPIVA8) (P450-KP1) (P450-PP1) Length = 508 Score = 29.3 bits (64), Expect = 5.9 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = +2 Query: 209 VFMFSVANIFWQH------MSNGNVPHNAIVGGHTSSNEPLYVARARVQGEMCVGKVCQS 370 +F F V N+F Q+ SNG HNA H +++ + +A++Q E + KV Q Sbjct: 225 LFFFRVQNMFHQNDFIYSLSSNGRKAHNAWQLAHDYTDQVIKSRKAQLQDEEELQKVKQK 284 Query: 371 HGCAFM 388 F+ Sbjct: 285 RRLDFL 290
>sp|P49953|WT1_SMIMA Wilms' tumor protein Length = 239 Score = 28.9 bits (63), Expect = 7.7 Identities = 18/67 (26%), Positives = 28/67 (41%) Frame = +1 Query: 19 GNQDNMDKVPYNAIQADPGLYILRCRTGGDLTIGKAKTGHSTGFFPYAGREDTIPNYEVL 198 G+Q + + PYN+ L C T + +G GH+TG Y T P +L Sbjct: 18 GSQALLLRTPYNSDNLYQMTSQLECMTWNQMNLGATLKGHTTG---YENDNHTTP---IL 71 Query: 199 CDTGFHV 219 C + + Sbjct: 72 CGAQYRI 78
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,233,190 Number of Sequences: 369166 Number of extensions: 1464151 Number of successful extensions: 3284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3284 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3403581975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)