Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_G06 (267 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53634|CATC_HUMAN Dipeptidyl-peptidase I precursor (DPP-... 110 1e-24 sp|Q60HG6|CATC_MACFA Dipeptidyl-peptidase I precursor (DPP-... 105 3e-23 sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precursor (DPP-... 105 3e-23 sp|Q26563|CATC_SCHMA Cathepsin C precursor 104 7e-23 sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor (DPP-... 102 3e-22 sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (DPP-I)... 100 1e-21 sp|Q26534|CATL_SCHMA Cathepsin L precursor (SMCL1) 77 1e-14 sp|P92131|CATB1_GIALA Cathepsin B-like CP1 precursor (Cathe... 74 1e-13 sp|P49935|CATH_MOUSE Cathepsin H precursor (Cathepsin B3) (... 72 3e-13 sp|P25807|CPR1_CAEEL Gut-specific cysteine proteinase precu... 72 4e-13
>sp|P53634|CATC_HUMAN Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 463 Score = 110 bits (274), Expect = 1e-24 Identities = 49/64 (76%), Positives = 56/64 (87%), Gaps = 1/64 (1%) Frame = +1 Query: 10 FNPFELTNHAVLVVGYG-ETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVA 186 FNPFELTNHAVL+VGYG +++SG +WIVKNSWG GWGENGYFRIRRG DEC IES+ VA Sbjct: 397 FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVA 456 Query: 187 SEPI 198 + PI Sbjct: 457 ATPI 460
>sp|Q60HG6|CATC_MACFA Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 463 Score = 105 bits (263), Expect = 3e-23 Identities = 47/64 (73%), Positives = 55/64 (85%), Gaps = 1/64 (1%) Frame = +1 Query: 10 FNPFELTNHAVLVVGYG-ETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVA 186 FNPFELTNHAVL+VGYG +++SG +WIVKNSWG WGE+GYFRIRRG DEC IES+ VA Sbjct: 397 FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVA 456 Query: 187 SEPI 198 + PI Sbjct: 457 ATPI 460
>sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain 1; Dipeptidyl-peptidase I heavy chain 2; Dipeptidyl-peptidase I heavy chain 3; Dipeptidyl-peptidase I heavy chain 4; Dipeptidyl-peptidase I light chain] Length = 435 Score = 105 bits (262), Expect = 3e-23 Identities = 47/64 (73%), Positives = 56/64 (87%), Gaps = 1/64 (1%) Frame = +1 Query: 10 FNPFELTNHAVLVVGYG-ETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVA 186 FNPFELTNHAVL+VGYG +++SG +WIVKNSWG+ WGE+GYFRIRRG DEC IES+ VA Sbjct: 369 FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGSRWGEDGYFRIRRGTDECAIESIAVA 428 Query: 187 SEPI 198 + PI Sbjct: 429 ATPI 432
>sp|Q26563|CATC_SCHMA Cathepsin C precursor Length = 454 Score = 104 bits (259), Expect = 7e-23 Identities = 47/67 (70%), Positives = 54/67 (80%), Gaps = 1/67 (1%) Frame = +1 Query: 4 FGFNPFELTNHAVLVVGYG-ETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLG 180 + FNPFELTNHAVL+VGYG + SGE +W VKNSWG WGE GYFRI RG DECG+ESLG Sbjct: 388 YNFNPFELTNHAVLLVGYGVDKLSGEPYWKVKNSWGVEWGEQGYFRILRGTDECGVESLG 447 Query: 181 VASEPIL 201 V +P+L Sbjct: 448 VRFDPVL 454
>sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 462 Score = 102 bits (254), Expect = 3e-22 Identities = 45/64 (70%), Positives = 55/64 (85%), Gaps = 1/64 (1%) Frame = +1 Query: 10 FNPFELTNHAVLVVGYG-ETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVA 186 FNPFELTNHAVL+VGYG + +G ++WI+KNSWG+ WGE+GYFRIRRG DEC IES+ VA Sbjct: 396 FNPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVA 455 Query: 187 SEPI 198 + PI Sbjct: 456 AIPI 459
>sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 462 Score = 100 bits (248), Expect = 1e-21 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = +1 Query: 10 FNPFELTNHAVLVVGYGETS-SGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVA 186 FNPFELTNHAVL+VGYG+ +G +WIVKNSWG+ WGE+GYFRIRRG DEC IES+ +A Sbjct: 396 FNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMA 455 Query: 187 SEPI 198 + PI Sbjct: 456 AIPI 459
>sp|Q26534|CATL_SCHMA Cathepsin L precursor (SMCL1) Length = 319 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 25 LTNHAVLVVGYGETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVAS 189 L +HAVL+VGYG + E FWIVKNSWG WGENGYFR+ RG+ CGI ++ ++ Sbjct: 262 LLDHAVLLVGYGVSEKNEPFWIVKNSWGVEWGENGYFRMYRGDGSCGINTVATSA 316
>sp|P92131|CATB1_GIALA Cathepsin B-like CP1 precursor (Cathepsin B-like protease B1) Length = 303 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = +1 Query: 1 KFGFNPFELTNHAVLVVGYGETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIE 171 K + L HA+ +VGYG T G +WI+KNSWG WGENGYFRI RG +EC IE Sbjct: 238 KHTYGTINLGFHALEIVGYGTTDDGTDYWIIKNSWGPDWGENGYFRIVRGVNECRIE 294
>sp|P49935|CATH_MOUSE Cathepsin H precursor (Cathepsin B3) (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 72.4 bits (176), Expect = 3e-13 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +1 Query: 31 NHAVLVVGYGETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVASEPI 198 NHAVL VGYGE +G +WIVKNSWG+ WGENGYF I RG + CG+ + AS PI Sbjct: 278 NHAVLAVGYGE-QNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAA--CASYPI 330
>sp|P25807|CPR1_CAEEL Gut-specific cysteine proteinase precursor Length = 329 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +1 Query: 25 LTNHAVLVVGYGETSSGEKFWIVKNSWGNGWGENGYFRIRRGNDECGIESLGVASE 192 L HA+ ++G+G T SG +W+V NSWG WGE+G+F+I RG+D+CGIES VA + Sbjct: 272 LGGHAIKIIGWG-TESGSPYWLVANSWGVNWGESGFFKIYRGDDQCGIESAVVAGK 326
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,057,022 Number of Sequences: 369166 Number of extensions: 631431 Number of successful extensions: 2131 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2021 length of database: 68,354,980 effective HSP length: 58 effective length of database: 57,640,350 effective search space used: 1729210500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)