Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_E02 (324 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O44783|SPY_DROME Protein sprouty (Spry) 32 0.34 sp|O97395|CLAPI_STYCL Clavaspirin precursor 31 1.00 sp|P02981|TCR3_ECOLI Tetracycline resistance protein, class... 30 1.3 sp|O18492|CLAVE_STYCL Clavanin E precursor 30 1.3 sp|P80710|CLAVA_STYCL Clavanin A precursor 30 1.7 sp|O18493|CLAVC_STYCL Clavanin C precursor 30 2.2 sp|P38565|MUCB1_XENLA Integumentary mucin B.1 (FIM-B.1) 29 3.8 sp|O81086|TPSD1_ABIGR Alpha-bisabolene synthase ((E)-alpha-... 28 5.0 sp|P80713|CLAVD_STYCL Clavanin D precursor 28 8.5
>sp|O44783|SPY_DROME Protein sprouty (Spry) Length = 589 Score = 32.3 bits (72), Expect = 0.34 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -3 Query: 247 DNLCSILHRCLLFLDQQFHIYLVNHR*SLQDKQLQ*PQRMQDKLHCEQHNQHH 89 DN + H LL + H++L H+ LQ +Q Q Q+ Q + Q NQ H Sbjct: 220 DNGQTTTHHLLLLPQRNQHLHLQQHQQHLQQQQQQQQQQQQQQHLQHQQNQQH 272
>sp|O97395|CLAPI_STYCL Clavaspirin precursor Length = 80 Score = 30.8 bits (68), Expect = 1.00 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 1 LLIALCVLSINAMKVEK----EEKIFGIVGDVLHGVGCAAHNV 117 L++ + L I+A +E+ EEK +G V+HG+G H++ Sbjct: 6 LILLILGLGIDAKSLEESKADEEKFLRFIGSVIHGIGHLVHHI 48
>sp|P02981|TCR3_ECOLI Tetracycline resistance protein, class C (TETA(C)) Length = 396 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +1 Query: 1 LLIALCVLSINAMKVEKEEKIF-GIVGDVLHGVGCAAHNVVCLAFFAATEVVC---LGAI 168 L++ L ++++A+ + + G++ D++H A+H V LA +A + +C LGA+ Sbjct: 7 LIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHYGVLLALYALMQFLCAPVLGAL 66 Query: 169 TD 174 +D Sbjct: 67 SD 68
>sp|O18492|CLAVE_STYCL Clavanin E precursor Length = 80 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +1 Query: 1 LLIALCVLSINAMKVEK----EEKIFGIVGDVLHGVGCAAH 111 L++ + L INA +E+ EEK+F ++G ++H VG H Sbjct: 6 LILLILGLGINAKSLEERKSEEEKLFKLLGKIIHHVGNFVH 46
>sp|P80710|CLAVA_STYCL Clavanin A precursor Length = 80 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = +1 Query: 1 LLIALCVLSINAMKVEK----EEKIFGIVGDVLHGVGCAAH 111 L++ + L INA +E+ EEK+F +G ++H VG H Sbjct: 6 LILLILGLGINAKSLEERKSEEEKVFQFLGKIIHHVGNFVH 46
>sp|O18493|CLAVC_STYCL Clavanin C precursor Length = 80 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 4/37 (10%) Frame = +1 Query: 1 LLIALCVLSINAMKVEK----EEKIFGIVGDVLHGVG 99 L++ + L INA +E+ EEK+F ++G ++H VG Sbjct: 6 LILLILGLGINAKSLEERKSEEEKVFHLLGKIIHHVG 42
>sp|P38565|MUCB1_XENLA Integumentary mucin B.1 (FIM-B.1) Length = 398 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 194 PHLSCKSSVIAPRQTTSVAAKNARQTTL*AAQPTPCRTSPTIPKIFSSFST 42 P + S AP +TT + +TT+ + + TP + T+P + S ST Sbjct: 36 PSETTGESTPAPSETTGESTPAPSETTVPSGESTPAPSETTVPSVPSGEST 86
>sp|O81086|TPSD1_ABIGR Alpha-bisabolene synthase ((E)-alpha-bisabolene synthase) (AgfEabis) Length = 817 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 133 FAATEVVCLGAITDDLQDKCGTVDQ 207 F T+V CL + DD+ D GT+D+ Sbjct: 553 FLFTKVACLQTVLDDMYDTYGTLDE 577
>sp|P80713|CLAVD_STYCL Clavanin D precursor Length = 80 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 1 LLIALCVLSINAMKVEK----EEKIFGIVGDVLHGVG 99 L++ + L INA +E+ EEK F ++G ++H VG Sbjct: 6 LILLILGLGINAKSLEERKSEEEKAFKLLGRIIHHVG 42
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,637,079 Number of Sequences: 369166 Number of extensions: 533702 Number of successful extensions: 1613 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1609 length of database: 68,354,980 effective HSP length: 76 effective length of database: 54,315,120 effective search space used: 1683768720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)