Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_014_B17 (364 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 (PI3-... 28 8.7 sp|O94644|YBV2_SCHPO Hypothetical protein C21.02 in chromos... 28 8.7
>sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 (PI3-kinase) (PtdIns-3-kinase) (PI3K) Length = 1585 Score = 27.7 bits (60), Expect = 8.7 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 182 VLTIHFSWILR*DNDRLCSIQRQRIRSKAVIFYAPLMLINVFDKTI 319 VL F W LR D D +R R+ S + YAP L+ F + I Sbjct: 1094 VLGHPFFWHLRADIDNQEVCERFRVLSSGFLRYAPTQLMESFKREI 1139
>sp|O94644|YBV2_SCHPO Hypothetical protein C21.02 in chromosome II Length = 511 Score = 27.7 bits (60), Expect = 8.7 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -3 Query: 272 SQLYFEFFAFVWNINGHYLIVRSN*SGLSTHAL--AMNNILSPSCPPIIAFQVNFFHLSI 99 +Q+ F VW +NG + R++ G S +AL M N +PS I A ++N H S Sbjct: 282 AQICFFLPKSVWQVNGLTSLFRASFHGYSMYALERKMCNYHNPSILLIKAKKINANHKSS 341 Query: 98 S 96 S Sbjct: 342 S 342
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,624,337 Number of Sequences: 369166 Number of extensions: 838273 Number of successful extensions: 1436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1436 length of database: 68,354,980 effective HSP length: 87 effective length of database: 52,283,035 effective search space used: 1725340155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)