Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_P17 (283 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O17488|TBP_ARTSF TATA-box binding protein (TATA-box fact... 28 6.5 sp|P26355|TBP_DICDI TATA-box binding protein (TATA-box fact... 28 6.5
>sp|O17488|TBP_ARTSF TATA-box binding protein (TATA-box factor) (TATA binding factor) (TATA sequence-binding protein) (TBP) (Transcription initiation factor TFIID TBP subunit) Length = 275 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 220 IICEVKLSTLLIDHKSQNLVIICKIKFPVLID 125 I+ ++ S +D K QN+V C +KFP+ ++ Sbjct: 178 IVQKLGFSAKFLDFKIQNMVGSCDVKFPIRLE 209
>sp|P26355|TBP_DICDI TATA-box binding protein (TATA-box factor) (TATA binding factor) (TATA sequence-binding protein) (TBP) (Transcription initiation factor TFIID TBP subunit) Length = 205 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 220 IICEVKLSTLLIDHKSQNLVIICKIKFPVLIDLFNS 113 II ++ D K QN+V C +KFP+ ++L ++ Sbjct: 102 IIQKLDFPARFTDFKIQNIVGSCDVKFPIKLELLHN 137
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,868,819 Number of Sequences: 369166 Number of extensions: 435794 Number of successful extensions: 1147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 68,354,980 effective HSP length: 63 effective length of database: 56,716,675 effective search space used: 1701500250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)