Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_I24 (860 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q10165|YAUA_SCHPO Hypothetical protein C26A3.10 in chrom... 31 3.9 sp|Q85C71|RPOC2_ANTFO DNA-directed RNA polymerase beta'' ch... 30 6.6
>sp|Q10165|YAUA_SCHPO Hypothetical protein C26A3.10 in chromosome I Length = 923 Score = 31.2 bits (69), Expect = 3.9 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +2 Query: 602 YGSTKSGNQHKIFNMICWKKSGLIIENNDLCESDILDFEIESNIANVKMK 751 +G+T+ G + + W K +++EN L E ++SN++++ +K Sbjct: 536 FGATELGTDLAMVSKAAWHKHWIVVENGSLWEYANWKDSVKSNVSSISLK 585
>sp|Q85C71|RPOC2_ANTFO DNA-directed RNA polymerase beta'' chain (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1445 Score = 30.4 bits (67), Expect = 6.6 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 623 NQHKIFNMICWKKSGLIIENNDLCESDILDFEIESNIANVKMK 751 +Q+KI N+I +S L+I+NN ES L E+ + ++ K K Sbjct: 394 SQNKIHNLIIPSQSLLLIQNNQYVESKQLIAEVHAKVSPFKEK 436
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,891,903 Number of Sequences: 369166 Number of extensions: 1743266 Number of successful extensions: 3365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3365 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8534739105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)