Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_B13 (671 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O32617|FTSH_HELFE Cell division protein ftsH homolog 32 1.1 sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle 32 2.0 sp|Q8BWJ3|KPB2_MOUSE Phosphorylase b kinase alpha regulator... 32 2.0 sp|Q8WT54|FAR1_WUCBA Fatty-acid and retinol-binding protein... 32 2.0 sp|Q962W7|FAR1_LOALO Fatty-acid and retinol-binding protein... 32 2.0 sp|P18106|FPS_DROME Tyrosine-protein kinase Fps85D (dFer) 31 2.6 sp|P41993|YKC2_CAEEL Hypothetical protein B0280.2 in chromo... 31 3.3 sp|Q8A455|SYE_BACTN Glutamyl-tRNA synthetase (Glutamate--tR... 31 3.3 sp|Q8BKE9|IFT74_MOUSE Intraflagellar transport 74 homolog (... 31 3.3 sp|P12753|RAD50_YEAST DNA repair protein RAD50 (153 kDa pro... 30 4.4
>sp|O32617|FTSH_HELFE Cell division protein ftsH homolog Length = 638 Score = 32.3 bits (72), Expect = 1.1 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 7/81 (8%) Frame = +2 Query: 143 ISEEKRNR---SDFESKSDWQERIALE----VKNFLRPAYMSKKITKSDYKEIMKRCVTK 301 + E++RN F S ++ E++A E +KN L Y+ K T SDYK+ ++ V + Sbjct: 542 VLEKQRNSFLGGGFGSGREFSEKMAEEMDSFIKNLLEERYVHVKQTLSDYKDAIEVMVNE 601 Query: 302 ISRSGVTEINTEKIEKFVLSY 364 + V I E++ + + Y Sbjct: 602 LFEKEV--ITGERVREIISEY 620
>sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle Length = 2116 Score = 31.6 bits (70), Expect = 2.0 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 4/102 (3%) Frame = +2 Query: 86 SNTAQTNQS-SKQLSSTSNEISEEKRNRSDFESKSDWQERIALEVKNFLRPAYMSKKI-- 256 SN ++ ++ QL + +NE+ EEK+NR E K + + E+K+ L KK Sbjct: 1083 SNVEKSKKTLESQLVAVNNELDEEKKNRDALEKKKKALDAMLEEMKDQLESTGGEKKSLY 1142 Query: 257 -TKSDYKEIMKRCVTKISRSGVTEINTEKIEKFVLSYVDKYQ 379 K + M+ +IS T EKI+ + V + Q Sbjct: 1143 DLKVKQESDMEALRNQISELQSTIAKLEKIKSTLEGEVARLQ 1184
>sp|Q8BWJ3|KPB2_MOUSE Phosphorylase b kinase alpha regulatory chain, liver isoform (Phosphorylase kinase alpha L subunit) Length = 1235 Score = 31.6 bits (70), Expect = 2.0 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 3/78 (3%) Frame = +2 Query: 113 SKQLSSTSNEISEEKRNRSDFESKSDWQERIA---LEVKNFLRPAYMSKKITKSDYKEIM 283 ++ L+ + E SE N S F+ KS ++ V+ +RP + S E+ Sbjct: 929 ARSLNCSGKEASESLMNLSPFDMKSLLHHILSGKEFGVERSVRPIHSSMSSPAISIHEVG 988 Query: 284 KRCVTKISRSGVTEINTE 337 TK RSG+T + +E Sbjct: 989 HTGATKTERSGITRLRSE 1006
>sp|Q8WT54|FAR1_WUCBA Fatty-acid and retinol-binding protein 1 precursor (Wb-FAR-1) Length = 178 Score = 31.6 bits (70), Expect = 2.0 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 1/97 (1%) Frame = +2 Query: 92 TAQTNQSSKQLSSTSNEISEEKRNRSDFESKSDWQERIALEVKNFLRPAYMS-KKITKSD 268 T + + ++L+S + E ++KSD + A+E++NF++ S K K+ Sbjct: 46 TVEDKEILRELASKHATFANEDAALEALKAKSDNLYKNAVELRNFVKAKIDSLKPDAKTF 105 Query: 269 YKEIMKRCVTKISRSGVTEINTEKIEKFVLSYVDKYQ 379 EI+ + + S G +++TEKI++ + KYQ Sbjct: 106 VDEIIAKARSLRSDDG-HKLDTEKIKQAARDIIAKYQ 141
>sp|Q962W7|FAR1_LOALO Fatty-acid and retinol-binding protein 1 precursor (Ll-FAR-1) (Ll20) Length = 178 Score = 31.6 bits (70), Expect = 2.0 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 1/97 (1%) Frame = +2 Query: 92 TAQTNQSSKQLSSTSNEISEEKRNRSDFESKSDWQERIALEVKNFLRPAYMS-KKITKSD 268 TA+ + + L+S + E + KSD + A+E++NF++ S K K+ Sbjct: 46 TAEDKEILRDLASKHATFANEDAALEALKDKSDKLYKNAVELRNFVKAKIDSLKPDAKAF 105 Query: 269 YKEIMKRCVTKISRSGVTEINTEKIEKFVLSYVDKYQ 379 E++ R + S G + +T+KI++ + KYQ Sbjct: 106 VDEVIARARSLRSDDG-QKFDTDKIKQAARDIIAKYQ 141
>sp|P18106|FPS_DROME Tyrosine-protein kinase Fps85D (dFer) Length = 1325 Score = 31.2 bits (69), Expect = 2.6 Identities = 22/62 (35%), Positives = 27/62 (43%) Frame = +2 Query: 176 ESKSDWQERIALEVKNFLRPAYMSKKITKSDYKEIMKRCVTKISRSGVTEINTEKIEKFV 355 E + QE L +N L+ A +T YKEI KR T I TE E EK+ Sbjct: 214 EHQQSVQESFILLWRNILQEAAQYGDLTADKYKEIQKRIDTVIGSINPTEEYGEFTEKYK 273 Query: 356 LS 361 S Sbjct: 274 TS 275
>sp|P41993|YKC2_CAEEL Hypothetical protein B0280.2 in chromosome III Length = 627 Score = 30.8 bits (68), Expect = 3.3 Identities = 24/120 (20%), Positives = 57/120 (47%), Gaps = 8/120 (6%) Frame = +2 Query: 32 LASSAAAIMANVSM--PLPMSNTAQTNQSSKQLSSTSNEISEEKRNRSDFESKSDWQERI 205 L+ S+ ++ +++M P P+ T++ +S L + +EI+ SKS+ Q + Sbjct: 502 LSDSSTSVAQDIAMKVPTPLPRTSKIISASSPLPPSQDEINPLIEMVDQSSSKSETQIPV 561 Query: 206 ALEVKNFLRPAYMSKKITKSDYKEIMKRCVT------KISRSGVTEINTEKIEKFVLSYV 367 ++ L + +I +D+ +++ + ++ K +S E+ IEK + +Y+ Sbjct: 562 TECSQSHLNGKGSAAQIQSADFDKVLNQLLSIKVNSEKSKQSADLELLLVSIEKLIQNYL 621
>sp|Q8A455|SYE_BACTN Glutamyl-tRNA synthetase (Glutamate--tRNA ligase) (GluRS) Length = 504 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +2 Query: 224 FLRPAYMSKKITKSDYKEIMKRCVTKISR--SGVTEINTEKIEKFVLSYV 367 F+ PA +K K +KE +C+T+++ +G+ + + E EK V+ ++ Sbjct: 404 FVAPAEYDEKTVKKRWKEDSAKCMTELAEVIAGIEDFSIEGQEKVVMDWI 453
>sp|Q8BKE9|IFT74_MOUSE Intraflagellar transport 74 homolog (Coiled-coil domain-containing protein 2) (Capillary morphogenesis protein 1) (CMG-1) Length = 600 Score = 30.8 bits (68), Expect = 3.3 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 7/114 (6%) Frame = +2 Query: 2 LPNYSDVLKPLASSAAAIMANVSMPLPMSNTAQTNQSSKQLSSTSNEISEEKRNRSDFES 181 L YSD L L SSA + + +T + N K + +++ KR D E+ Sbjct: 481 LETYSD-LAALKSSAEEKKKKLHQERTVLSTHR-NAFKKIMEKLTSDYDTLKRQLQDNET 538 Query: 182 KSD-------WQERIALEVKNFLRPAYMSKKITKSDYKEIMKRCVTKISRSGVT 322 + WQ LE NF+ +++ K +SDY+ ++K + +I+ T Sbjct: 539 HAQLTNLERKWQH---LEQNNFVMKEFIATKSQESDYQPVIKNVMKQIAEYNKT 589
>sp|P12753|RAD50_YEAST DNA repair protein RAD50 (153 kDa protein) Length = 1312 Score = 30.4 bits (67), Expect = 4.4 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +2 Query: 89 NTAQTNQSSKQLSSTSNEISEEKRNRSDF--ESKSDWQERIALEVKNFLRPAYMSKKITK 262 N AQ + +QL SNE++EEKR +D E K+ Q +E+K+ L+ ++ +I++ Sbjct: 990 NKAQMLELKEQLDLKSNEVNEEKRKLADSNNEEKNLKQNLELIELKSQLQ--HIESEISR 1047 Query: 263 SD 268 D Sbjct: 1048 LD 1049
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,305,377 Number of Sequences: 369166 Number of extensions: 1044243 Number of successful extensions: 3196 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3195 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 5636246860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)