Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_A18 (254 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P01040|CYTA_HUMAN Cystatin A (Stefin A) (Cystatin AS) 33 0.20 sp|Q95150|NT3_CEREL Neurotrophin-3 precursor (NT-3) 30 1.3 sp|P35479|CPI1_PIG Leukocyte cysteine proteinase inhibitor ... 29 2.9 sp|P01041|CYTB_RAT Cystatin B (Liver thiol proteinase inhib... 28 5.0 sp|Q62426|CYTB_MOUSE Cystatin B (Stefin B) 28 6.5
>sp|P01040|CYTA_HUMAN Cystatin A (Stefin A) (Cystatin AS) Length = 98 Score = 33.1 bits (74), Expect = 0.20 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = +2 Query: 2 DGKHIHIRVYQPLPGQG-DLALHGLQ-EKLKEDVLEYF 109 D K++H++V++ LPGQ DL L G Q +K K+D L F Sbjct: 61 DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF 98
>sp|Q95150|NT3_CEREL Neurotrophin-3 precursor (NT-3) Length = 154 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -1 Query: 146 RRYNNIFPIIIDQSILEHPPLIFLEVHVMQDPLDQEVVDKREY 18 RRYN+ ++ D LE PPL +EVH+ ++ ++ Y Sbjct: 93 RRYNSSRFLLSDSIPLESPPLFLIEVHLANPMVNSRSPRRKRY 135
>sp|P35479|CPI1_PIG Leukocyte cysteine proteinase inhibitor 1 (PLCPI) (Stefin D1) Length = 103 Score = 29.3 bits (64), Expect = 2.9 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +2 Query: 11 HIHIRVYQPLPGQGD-LALHGLQ-EKLKEDVLEYF 109 ++HIRV+Q LP Q D L L G Q +K K+D L F Sbjct: 69 YVHIRVFQSLPHQEDPLKLIGYQVDKTKDDELTGF 103
>sp|P01041|CYTB_RAT Cystatin B (Liver thiol proteinase inhibitor) (Stefin B) (Cystatin beta) Length = 98 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +2 Query: 8 KHIHIRVYQPLPGQG-DLALHGLQ-EKLKEDVLEYF 109 K +H+RV++PLP + L L Q +K K D L YF Sbjct: 63 KCVHLRVFEPLPHENKPLTLSSYQTDKEKHDELTYF 98
>sp|Q62426|CYTB_MOUSE Cystatin B (Stefin B) Length = 98 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 8 KHIHIRVYQPLPGQG-DLALHGLQ-EKLKEDVLEYF 109 K +H+RV+QPLP + L L Q K + D L YF Sbjct: 63 KCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF 98
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,320,498 Number of Sequences: 369166 Number of extensions: 433879 Number of successful extensions: 879 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 68,354,980 effective HSP length: 55 effective length of database: 58,194,555 effective search space used: 1687642095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)