Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_P12 (377 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 (CYPVIJ1) 30 2.2 sp|O13798|CID16_SCHPO Caffeine-induced protein 16 28 5.0
>sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 (CYPVIJ1) Length = 501 Score = 29.6 bits (65), Expect = 2.2 Identities = 20/45 (44%), Positives = 23/45 (51%) Frame = +1 Query: 40 PMCLIYFLNFSHFNKFFWKIFGFSPSPGSPHFRNLEERTLAKKRI 174 P+CL FL HFN FWK G P F NL++ L KK I Sbjct: 19 PICLYLFLT-RHFN--FWKKRGVIYVRPLPFFGNLKDVLLQKKYI 60
>sp|O13798|CID16_SCHPO Caffeine-induced protein 16 Length = 1202 Score = 28.5 bits (62), Expect = 5.0 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -1 Query: 248 HATSETGTKSRKNKCYIYKYKYSVDIRFFAKVRSSKLRKCGEPGLGEKPNIFQKNLL 78 H S T SRK +I YK I + V+ +KL+ E + N+F KNL+ Sbjct: 739 HTVSSASTSSRK---FIENYKSLESIGLTSFVKDNKLKASKELQKLIEENVFPKNLI 792
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,878,970 Number of Sequences: 369166 Number of extensions: 562535 Number of successful extensions: 1177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1177 length of database: 68,354,980 effective HSP length: 92 effective length of database: 51,359,360 effective search space used: 1694858880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)