Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_O23 (321 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O88281|EGFL3_RAT Multiple EGF-like-domain protein 3 prec... 33 0.20 sp|O35806|LTBP2_RAT Latent transforming growth factor-beta-... 30 1.3 sp|O08999|LTBP2_MOUSE Latent transforming growth factor-bet... 30 1.3 sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protei... 30 1.7 sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein ... 30 1.7 sp|Q9XUC4|YGJK_CAEEL Hypothetical protein T28F3.3 in chromo... 30 2.2 sp|Q80V70|EGFL3_MOUSE Multiple EGF-like-domain protein 3 30 2.2 sp|P24821|TENA_HUMAN Tenascin precursor (TN) (Hexabrachion)... 30 2.2 sp|P11047|LAMC1_HUMAN Laminin gamma-1 chain precursor (Lami... 29 2.9 sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protei... 29 3.8
>sp|O88281|EGFL3_RAT Multiple EGF-like-domain protein 3 precursor (Multiple epidermal growth factor-like domains 6) Length = 1574 Score = 33.1 bits (74), Expect = 0.20 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 75 PGVTAGHCDDGCHDTKAKPHCDDGCH 152 PGV+ HC+DGC HC CH Sbjct: 591 PGVSGAHCEDGCPKGFYGKHCRKKCH 616
>sp|O35806|LTBP2_RAT Latent transforming growth factor-beta-binding protein 2 precursor (LTBP-2) Length = 1764 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 60 DDCHKPGVTAGHCDDGCHDTKAKPHCDDGCHAPGVKSDHCKD 185 D+C +PGV +G C +T+ HC+ V+ HC+D Sbjct: 922 DECEQPGVCSG---GRCSNTEGSYHCECDQGYVMVRRGHCQD 960
>sp|O08999|LTBP2_MOUSE Latent transforming growth factor-beta-binding protein 2 precursor (LTBP-2) Length = 1813 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 60 DDCHKPGVTAGHCDDGCHDTKAKPHCDDGCHAPGVKSDHCKD 185 D+C +PGV +G C +T+ HC+ V+ HC+D Sbjct: 923 DECEQPGVCSG---GRCSNTEGSYHCECDRGYIMVRKGHCQD 961
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 precursor (Notch 1) (Motch A) (mT14) (p300) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 13/48 (27%) Frame = +3 Query: 51 HCKDDCHKPG---------VTAGHC----DDGCHDTKAKPHCDDGCHA 155 HC C+ G +T G C D C D + HCD GC++ Sbjct: 1504 HCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNS 1551
>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 precursor (Notch 1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 13/48 (27%) Frame = +3 Query: 51 HCKDDCHKPG---------VTAGHC----DDGCHDTKAKPHCDDGCHA 155 HC C+ G +T G C D C D + HCD GC++ Sbjct: 1504 HCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNS 1551
>sp|Q9XUC4|YGJK_CAEEL Hypothetical protein T28F3.3 in chromosome IV Length = 393 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 174 DLTSHQEHDIHHHNEALLLYRDNHHRNAQ 88 +L H EHD HH+E L+ HR Q Sbjct: 46 ELHDHHEHDHDHHDEQLIRKNHTSHREIQ 74
>sp|Q80V70|EGFL3_MOUSE Multiple EGF-like-domain protein 3 Length = 656 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/38 (31%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 51 HCKDDCH-KPGVTAGHCDDGCHDTKAKPHCDDGCHAPG 161 H +CH PG T C+ C C+ C PG Sbjct: 271 HVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPG 308
Score = 28.9 bits (63), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 75 PGVTAGHCDDGCHDTKAKPHCDDGC 149 PG T GHC+ GC + C+ C Sbjct: 410 PGKTGGHCERGCPQDRFGKGCEHKC 434
>sp|P24821|TENA_HUMAN Tenascin precursor (TN) (Hexabrachion) (Cytotactin) (Neuronectin) (GMEM) (JI) (Miotendinous antigen) (Glioma-associated-extracellular matrix antigen) (GP 150-225) (Tenascin-C) (TN-C) Length = 2201 Score = 29.6 bits (65), Expect = 2.2 Identities = 19/68 (27%), Positives = 24/68 (35%), Gaps = 21/68 (30%) Frame = +3 Query: 54 CKDDCHKPGVTAGH---CDDG-----CHDTKAKPHC-------------DDGCHAPGVKS 170 C +DCH+ G CDDG C D + C +DG P Sbjct: 470 CPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAE 529 Query: 171 DHCKDDCH 194 C +DCH Sbjct: 530 LSCPNDCH 537
>sp|P11047|LAMC1_HUMAN Laminin gamma-1 chain precursor (Laminin B2 chain) Length = 1609 Score = 29.3 bits (64), Expect = 2.9 Identities = 21/68 (30%), Positives = 24/68 (35%), Gaps = 21/68 (30%) Frame = +3 Query: 48 EHCKDDCHKPGVTAGHCDDGCHDTKAKP-----HCDD----------------GCHAPGV 164 E C DCH G T G CD + +P HC+ CH G Sbjct: 933 ERC--DCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGS 990 Query: 165 KSDHCKDD 188 S CKDD Sbjct: 991 LSLQCKDD 998
>sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 precursor (Notch 4) (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 63 DCHKPGVTAGHCDDGCHDTKAKPHCDDGCH 152 DC P D CHD HC+ GC+ Sbjct: 1244 DCETPPACTPAYDQYCHDHFHNGHCEKGCN 1273
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,432,632 Number of Sequences: 369166 Number of extensions: 621141 Number of successful extensions: 1974 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1943 length of database: 68,354,980 effective HSP length: 75 effective length of database: 54,499,855 effective search space used: 1689495505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)