Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_O08 (282 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O01159|RSP7_CAEEL Probable splicing factor, arginine/ser... 29 3.8 sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B (M... 28 6.5 sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 ... 28 8.6
>sp|O01159|RSP7_CAEEL Probable splicing factor, arginine/serine-rich 7 (p54) Length = 452 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 6 KARETSRDTKGRETSRDTKGRETSRETKKETR 101 + R SRD K R SRD K R+ R ++ R Sbjct: 322 RKRSRSRDRKRRSRSRDNKDRDRKRSRSRDRR 353
>sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B (Monoamine oxidase type B) (MAO-B) Length = 520 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 60 KGRETSRETKKET-RFFCQSWKVFW*SSQSGKRYHQTHKGWCQENCS 197 K R+ +R TK+E + C+ + S ++ K H K WC+E S Sbjct: 348 KARKLARLTKEERLKKLCELYAKVLGSKEALKPVHYEEKNWCEEQYS 394
>sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (snRNP70) (U1-70K) Length = 437 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 6 KARETSRDTKGRETSRDTKGRETSRETKKE 95 + R SRD + R SRD + R SRE K+ Sbjct: 254 RRRSRSRDRRRRSRSRDKEERRRSRERSKD 283
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,316,218 Number of Sequences: 369166 Number of extensions: 250150 Number of successful extensions: 722 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 68,354,980 effective HSP length: 63 effective length of database: 56,716,675 effective search space used: 1701500250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)