Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_O03 (445 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P41824|YBOXH_APLCA Y-box factor homolog (APY1) 50 3e-06 sp|P21573|YBOX1_XENLA Nuclease sensitive element binding pr... 47 1e-05 sp|P62960|YBOX1_MOUSE Nuclease sensitive element binding pr... 47 1e-05 sp|P67809|YBOX1_HUMAN Nuclease sensitive element binding pr... 47 1e-05 sp|Q06066|YBOX1_CHICK Nuclease sensitive element binding pr... 47 1e-05 sp|Q9JKB3|DBPA_MOUSE DNA-binding protein A (Cold shock doma... 47 2e-05 sp|P16989|DBPA_HUMAN DNA-binding protein A (Cold shock doma... 47 2e-05 sp|Q62764|DBPA_RAT DNA-binding protein A (Cold shock domain... 47 2e-05 sp|P45441|YBX2B_XENLA Y-box binding protein 2-B (Cytoplasmi... 46 3e-05 sp|Q9Y2T7|YBOX2_HUMAN Y-box binding protein 2 (Germ cell-sp... 46 3e-05
>sp|P41824|YBOXH_APLCA Y-box factor homolog (APY1) Length = 253 Score = 49.7 bits (117), Expect = 3e-06 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +3 Query: 3 VHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 VH +I N S+ DGE+V FD+VEG KG EA NVTGP G +V G K Sbjct: 60 VHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSK 111
>sp|P21573|YBOX1_XENLA Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) Length = 303 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G K Sbjct: 80 SVGDGETVEFDVVEGEKGAEAANVTGPEGVPVQGSK 115
>sp|P62960|YBOX1_MOUSE Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) sp|P62961|YBOX1_RAT Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) Length = 322 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G K Sbjct: 100 SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 135
>sp|P67809|YBOX1_HUMAN Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) sp|P67808|YBOX1_BOVIN Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) Length = 324 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G K Sbjct: 102 SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 137
>sp|Q06066|YBOX1_CHICK Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) Length = 321 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G K Sbjct: 99 SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 134
>sp|Q9JKB3|DBPA_MOUSE DNA-binding protein A (Cold shock domain protein A) (Y-box protein 3) sp|Q5PQD5|DBPA_XENLA DNA-binding protein A (Cold shock domain protein A) Length = 361 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP+G V G + Sbjct: 126 SVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 161
>sp|P16989|DBPA_HUMAN DNA-binding protein A (Cold shock domain protein A) (Single-strand DNA binding protein NF-GMB) Length = 372 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP+G V G + Sbjct: 134 SVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 169
>sp|Q62764|DBPA_RAT DNA-binding protein A (Cold shock domain protein A) (Muscle Y-box protein YB2) (Y-box binding protein-A) (RYB-A) Length = 361 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP+G V G + Sbjct: 126 SVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 161
>sp|P45441|YBX2B_XENLA Y-box binding protein 2-B (Cytoplasmic RNA-binding protein p54) (mRNP3) Length = 324 Score = 46.2 bits (108), Expect = 3e-05 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G + Sbjct: 85 SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSR 120
>sp|Q9Y2T7|YBOX2_HUMAN Y-box binding protein 2 (Germ cell-specific Y-box binding protein) (Contrin) (MSY2 homolog) Length = 364 Score = 46.2 bits (108), Expect = 3e-05 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +3 Query: 39 SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVIGGK 146 S+ DGE V FD+VEG KG EA NVTGP G V G + Sbjct: 137 SVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSR 172
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,916,976 Number of Sequences: 369166 Number of extensions: 360977 Number of successful extensions: 1270 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1269 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2344429560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)