Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_N08 (872 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P98170|BIRC4_HUMAN Baculoviral IAP repeat-containing pro... 66 1e-10 sp|Q24307|IAP2_DROME Apoptosis 2 inhibitor (Inhibitor of ap... 64 7e-10 sp|Q9R0I6|BIRC4_RAT Baculoviral IAP repeat-containing prote... 63 9e-10 sp|Q60989|BIRC4_MOUSE Baculoviral IAP repeat-containing pro... 63 1e-09 sp|Q86YT6|MIB1_HUMAN Ubiquitin ligase protein MIB1 (Mind bo... 62 3e-09 sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing pro... 61 4e-09 sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein (IAP) (I... 61 5e-09 sp|Q96P09|BIRC8_HUMAN Baculoviral IAP repeat-containing pro... 60 8e-09 sp|Q95M71|BIRC8_GORGO Baculoviral IAP repeat-containing pro... 60 8e-09 sp|Q95M72|BIRC8_PANTR Baculoviral IAP repeat-containing pro... 60 8e-09
>sp|P98170|BIRC4_HUMAN Baculoviral IAP repeat-containing protein 4 (Inhibitor of apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP-like protein) (HILP) Length = 497 Score = 65.9 bits (159), Expect = 1e-10 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 12/91 (13%) Frame = +1 Query: 244 TGKDYDSIHEFLSDLKNYREIKHSVQEDNYQ------------LEFIFPNNYCVVCLDKQ 387 +G +Y S+ ++DL N + K S+Q+++ Q L + C +C+D+ Sbjct: 400 SGSNYKSLEVLVADLVNAQ--KDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRN 457 Query: 388 VAVVFLPCGHLKTCNDCSNLLSSCPVCGTVI 480 +A+VF+PCGHL TC C+ + CP+C TVI Sbjct: 458 IAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 488
>sp|Q24307|IAP2_DROME Apoptosis 2 inhibitor (Inhibitor of apoptosis 2) (dIAP2) (DIAP) (IAP homolog A) (IAP-like protein) (DILP) Length = 498 Score = 63.5 bits (153), Expect = 7e-10 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 313 SVQEDNYQLEFIFPNNYCVVCLDKQVAVVFLPCGHLKTCNDCSNLLSSCPVC 468 S++E+N QL+ C VCLD++V VVFLPCGHL TCN C+ +++CP+C Sbjct: 437 SLEEENRQLK---DARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMC 485
>sp|Q9R0I6|BIRC4_RAT Baculoviral IAP repeat-containing protein 4 (Inhibitor of apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP homolog A) (RIAP3) (RIAP-3) Length = 496 Score = 63.2 bits (152), Expect = 9e-10 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 10/89 (11%) Frame = +1 Query: 244 TGKDYDSIHEFLSDLKNYRE-------IKHSVQED---NYQLEFIFPNNYCVVCLDKQVA 393 +G +Y S+ ++DL + ++ + S+Q+D QL + C +C+D+ +A Sbjct: 399 SGSNYLSLEVLIADLVSAQKDNSQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA 458 Query: 394 VVFLPCGHLKTCNDCSNLLSSCPVCGTVI 480 +VF+PCGHL TC C+ + CP+C TVI Sbjct: 459 IVFVPCGHLVTCKQCAEAVDKCPMCCTVI 487
>sp|Q60989|BIRC4_MOUSE Baculoviral IAP repeat-containing protein 4 (Inhibitor of apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP homolog A) (MIAP3) (MIAP-3) Length = 496 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 10/89 (11%) Frame = +1 Query: 244 TGKDYDSIHEFLSDLKNYRE-------IKHSVQED---NYQLEFIFPNNYCVVCLDKQVA 393 +G Y S+ ++DL + ++ + S+Q+D QL + C +C+D+ +A Sbjct: 399 SGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA 458 Query: 394 VVFLPCGHLKTCNDCSNLLSSCPVCGTVI 480 +VF+PCGHL TC C+ + CP+C TVI Sbjct: 459 IVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487
>sp|Q86YT6|MIB1_HUMAN Ubiquitin ligase protein MIB1 (Mind bomb homolog 1) (DAPK-interacting protein 1) (DIP-1) (Zinc finger ZZ type with ankyrin repeat domain protein 2) Length = 1006 Score = 61.6 bits (148), Expect = 3e-09 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +1 Query: 364 CVVCLDKQVAVVFLPCGHLKTCNDCSNLLSSCPVCGTVIERRV 492 CVVC DK+ AV+F PCGH+ C +C+NL+ C C V+ERRV Sbjct: 866 CVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRV 908
Score = 52.4 bits (124), Expect = 2e-06 Identities = 27/68 (39%), Positives = 38/68 (55%) Frame = +1 Query: 289 KNYREIKHSVQEDNYQLEFIFPNNYCVVCLDKQVAVVFLPCGHLKTCNDCSNLLSSCPVC 468 K+ + VQ+ QL+ I C VCLD+ ++FL CGH TC C + +S CP+C Sbjct: 938 KDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFL-CGH-GTCQLCGDRMSECPIC 995 Query: 469 GTVIERRV 492 IERR+ Sbjct: 996 RKAIERRI 1003
Score = 42.7 bits (99), Expect = 0.001 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 364 CVVCLDKQVAVVFLPCGHLKTCNDCSNLLSSCPVCGTVIERR 489 C+VC D + +F PCGH+ TC+ CS + C +C ++ R Sbjct: 819 CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSR 860
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 (Inhibitor of apoptosis protein 1) (HIAP1) (HIAP-1) (C-IAP2) (TNFR2-TRAF signaling complex protein 1) (IAP homolog C) (Apoptosis inhibitor 2) (API2) Length = 604 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 6/71 (8%) Frame = +1 Query: 298 REIKHSVQED------NYQLEFIFPNNYCVVCLDKQVAVVFLPCGHLKTCNDCSNLLSSC 459 ++IK+ ED QL + C VC+DK+V++VF+PCGHL C DC+ L C Sbjct: 529 QDIKYIPTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKC 588 Query: 460 PVCGTVIERRV 492 P+C + I+ V Sbjct: 589 PICRSTIKGTV 599
>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein (IAP) (Inhibitor of T cell apoptosis protein) Length = 611 Score = 60.8 bits (146), Expect = 5e-09 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 7/83 (8%) Frame = +1 Query: 250 KDYDSIHEFLSDLKNYREIKHSVQED------NYQLEFIFPNNYCVVCLDKQVAVVFLPC 411 KD+D + DL + +K+ ED QL + C VC+DK+V++VF+PC Sbjct: 522 KDFDPV--LYKDLFVEKSMKYVPTEDVSGLPMEEQLRRLQEERTCKVCMDKEVSIVFIPC 579 Query: 412 GHLKTCNDCSNLLSSCPVC-GTV 477 GHL C +C+ L CP+C GT+ Sbjct: 580 GHLVVCKECAPSLRKCPICRGTI 602
>sp|Q96P09|BIRC8_HUMAN Baculoviral IAP repeat-containing protein 8 (Inhibitor of apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) (Testis-specific inhibitor of apoptosis) Length = 236 Score = 60.1 bits (144), Expect = 8e-09 Identities = 26/90 (28%), Positives = 50/90 (55%), Gaps = 10/90 (11%) Frame = +1 Query: 244 TGKDYDSIHEFLSDLKNYRE--IKHSVQEDNYQLEF--------IFPNNYCVVCLDKQVA 393 +G +Y ++ ++DL + ++ ++ + + + Q E + C +C+D+ +A Sbjct: 139 SGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRYIA 198 Query: 394 VVFLPCGHLKTCNDCSNLLSSCPVCGTVIE 483 VVF+PCGHL TC C+ + CP+C VI+ Sbjct: 199 VVFIPCGHLVTCKQCAEAVDRCPMCSAVID 228
>sp|Q95M71|BIRC8_GORGO Baculoviral IAP repeat-containing protein 8 (Inhibitor of apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) Length = 236 Score = 60.1 bits (144), Expect = 8e-09 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 11/91 (12%) Frame = +1 Query: 244 TGKDYDSIHEFLSDL-----------KNYREIKHSVQEDNYQLEFIFPNNYCVVCLDKQV 390 +G +Y ++ ++DL N ++ + + L + C +C+D+ + Sbjct: 139 SGSNYKTLEVLVADLVSAQKDTTENESNQTSLQREISPEE-PLRRLQEEKLCKICMDRHI 197 Query: 391 AVVFLPCGHLKTCNDCSNLLSSCPVCGTVIE 483 AVVF+PCGHL TC C+ + CP+C VI+ Sbjct: 198 AVVFIPCGHLVTCKQCAEAVDRCPMCNAVID 228
>sp|Q95M72|BIRC8_PANTR Baculoviral IAP repeat-containing protein 8 (Inhibitor of apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) Length = 236 Score = 60.1 bits (144), Expect = 8e-09 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 11/91 (12%) Frame = +1 Query: 244 TGKDYDSIHEFLSDL-----------KNYREIKHSVQEDNYQLEFIFPNNYCVVCLDKQV 390 +G +Y ++ ++DL N ++ + + L + C +C+D+ + Sbjct: 139 SGSNYKTLEVLVADLVSAQKDTTENESNQTSLQREISPEE-PLRRLQDEKLCKICMDRHI 197 Query: 391 AVVFLPCGHLKTCNDCSNLLSSCPVCGTVIE 483 AVVF+PCGHL TC C+ + CP+C VI+ Sbjct: 198 AVVFIPCGHLVTCKQCAEAVDRCPMCSAVID 228
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,352,016 Number of Sequences: 369166 Number of extensions: 1839187 Number of successful extensions: 5778 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5764 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 8646143400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)