Planarian EST Database


Dr_sW_012_M23

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_012_M23
         (532 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q8VWV6|WRK61_ARATH  Probable WRKY transcription factor 61...    30   2.8  
>sp|Q8VWV6|WRK61_ARATH Probable WRKY transcription factor 61 (WRKY DNA-binding protein 61)
          Length = 480

 Score = 30.4 bits (67), Expect = 2.8
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +2

Query: 89  NGLGYKSKQKRHEEPDPVDPASLVHKKKETLRD-SYNPLMGDTC 217
           N  G+K+    HE+ D + P +LV K + ++R     P M D C
Sbjct: 151 NSFGFKNDGDDHEDEDEILPQNLVKKTRVSVRSRCETPTMNDGC 194
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,730,961
Number of Sequences: 369166
Number of extensions: 727541
Number of successful extensions: 2040
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1988
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2034
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3600891075
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)