Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_K11-2 (509 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P49327|FAS_HUMAN Fatty acid synthase [Includes: [Acyl-ca... 29 5.6 sp|P39720|YAF1_YEAST Putative 118.2 kDa transcriptional reg... 29 5.6
>sp|P49327|FAS_HUMAN Fatty acid synthase [Includes: [Acyl-carrier-protein] S-acetyltransferase ; [Acyl-carrier-protein] S-malonyltransferase ; 3-oxoacyl-[acyl-carrier-protein] synthase ; 3-oxoacyl-[acyl-carrier-protein] reductase ; 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase ; Enoyl-[acyl-carrier-protein] reductase ; Oleoyl-[acyl-carrier-protein] hydrolase ] Length = 2511 Score = 29.3 bits (64), Expect = 5.6 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 115 DVYLGGTCGNSNWRERIAIPLLQKAACSFYNPKMNNAEWSRKLLP 249 +V GG +S + E IA PLLQ+ PK +A W +P Sbjct: 674 EVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIP 718
>sp|P39720|YAF1_YEAST Putative 118.2 kDa transcriptional regulatory protein in ACS1-GCV3 intergenic region Length = 1062 Score = 29.3 bits (64), Expect = 5.6 Identities = 19/63 (30%), Positives = 35/63 (55%) Frame = -2 Query: 190 QLFVIMVLLFSLSNYYFHMYHLNTHRISGLRPLIVVQV*SVLDLVPLQLIATV*LQIDEM 11 QL +++ L +L+ Y+ +HL H I +R I + V +VPL+ +A +D+M Sbjct: 601 QLALLLSDLDNLTMTYYGSFHL--HSIEFIREKIEIFVEENFPIVPLKSVAQDKSDLDDM 658 Query: 10 DII 2 ++I Sbjct: 659 NVI 661
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,909,324 Number of Sequences: 369166 Number of extensions: 982417 Number of successful extensions: 2466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2466 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3255600150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)