Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_D09 (803 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P33418|LOS1_YEAST Protein LOS1 32 2.7 sp|O51083|SECG_BORBU Probable protein-export membrane prote... 30 7.7
>sp|P33418|LOS1_YEAST Protein LOS1 Length = 1100 Score = 31.6 bits (70), Expect = 2.7 Identities = 26/93 (27%), Positives = 42/93 (45%) Frame = +3 Query: 183 IIRFLKELLYFRIYLWRIYIRKVMWLS*QLIYRFSNMILSYGIFQKDKTSIEIKFIAYYT 362 ++RFL ELL + +L I ++ L +LI + N I S + T + K++ Sbjct: 524 LVRFLNELLMMKDFLLAIDNEQIQILFMELIVKNYNFIFSTSANTANATDDDEKYLLILN 583 Query: 363 IVYYMFIILIKFINVELKR**YLLVSTNFLLIT 461 I F + K NV L+ + T FL +T Sbjct: 584 IFMSSFAMFNKRENVRLRS---WYLFTRFLKLT 613
>sp|O51083|SECG_BORBU Probable protein-export membrane protein secG Length = 125 Score = 30.0 bits (66), Expect = 7.7 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = +3 Query: 300 SYGIFQKDKTSIEIKFIAYYTIVYYMFIILIKFIN 404 S IF +S+ +K ++ ++++F++L+ F+N Sbjct: 46 SSSIFGAKSSSVAVKITGFFIALFFIFVVLLSFLN 80
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,361,630 Number of Sequences: 369166 Number of extensions: 1483505 Number of successful extensions: 2764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2763 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 7618580670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)