Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_011_O19-1 (159 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P51834|SMC_BACSU Chromosome partition protein smc 28 5.1 sp|P91349|SPD5_CAEEL Spindle-defective protein 5 28 8.6
>sp|P51834|SMC_BACSU Chromosome partition protein smc Length = 1186 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 3 EGEQKVQIMGEELDRLKQYLTSTEKELNDLRKT 101 E E+K ++ +E+ LK + EK+L DLR+T Sbjct: 688 EMEEKTALLEQEVKTLKHSIQDMEKKLADLRET 720
>sp|P91349|SPD5_CAEEL Spindle-defective protein 5 Length = 1198 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/35 (34%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +3 Query: 3 EGEQKVQIMGEE-LDRLKQYLTSTEKELNDLRKTL 104 +GEQ+ ++ E L+ +Q ++S + E N+L+KT+ Sbjct: 799 DGEQETRVKAENALEEARQLISSLKHEENELKKTI 833
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,166,337 Number of Sequences: 369166 Number of extensions: 147680 Number of successful extensions: 755 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 68,354,980 effective HSP length: 25 effective length of database: 63,736,605 effective search space used: 1720888335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)