Dr_sW_011_K02
- ACCESSION : BW638444
- GO Category :
Not Available
- EST Sequence :
BLASTX 2.2.12 [Aug-07-2005]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_011_K02
(281 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB 30 1.7
>sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB
Length = 373
Score = 30.0 bits (66), Expect = 1.7
Identities = 20/67 (29%), Positives = 29/67 (43%)
Frame = +1
Query: 7 WADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 186
+A GE++ K GG AR + VVVG G + Y HR+D++E
Sbjct: 213 YATGEHLRKAVPSGG---------ARHPIEFYVVVGDEIAGIEAGVYHYNVRHHRLDAIE 263
Query: 187 VLCCSTK 207
+ S K
Sbjct: 264 IASTSLK 270
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,705,100
Number of Sequences: 369166
Number of extensions: 632064
Number of successful extensions: 2024
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1963
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2020
length of database: 68,354,980
effective HSP length: 63
effective length of database: 56,716,675
effective search space used: 1701500250
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)