Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_011_I24 (623 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P21574|YBX2A_XENLA Y-box binding protein 2-A (Cytoplasmi... 91 2e-18 sp|P41824|YBOXH_APLCA Y-box factor homolog (APY1) 90 4e-18 sp|P45441|YBX2B_XENLA Y-box binding protein 2-B (Cytoplasmi... 90 5e-18 sp|Q9Y2T7|YBOX2_HUMAN Y-box binding protein 2 (Germ cell-sp... 88 2e-17 sp|P21573|YBOX1_XENLA Nuclease sensitive element binding pr... 88 2e-17 sp|P62960|YBOX1_MOUSE Nuclease sensitive element binding pr... 88 2e-17 sp|P67809|YBOX1_HUMAN Nuclease sensitive element binding pr... 88 2e-17 sp|Q06066|YBOX1_CHICK Nuclease sensitive element binding pr... 88 2e-17 sp|Q9Z2C8|YBOX2_MOUSE Y-box binding protein 2 (Germ cell-sp... 86 6e-17 sp|Q00436|YB3_XENLA B box binding protein (YB3 protein) 86 1e-16
>sp|P21574|YBX2A_XENLA Y-box binding protein 2-A (Cytoplasmic RNA-binding protein p56) (mRNP4) Length = 336 Score = 90.9 bits (224), Expect = 2e-18 Identities = 48/86 (55%), Positives = 62/86 (72%), Gaps = 2/86 (2%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 55 YGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV 114 Query: 178 AVQGSKFAPN-NDFQNRNHRDNANNS 252 V+GS+FAPN F+ R +R A+ + Sbjct: 115 PVKGSRFAPNRRRFRRRFYRPRADTA 140
>sp|P41824|YBOXH_APLCA Y-box factor homolog (APY1) Length = 253 Score = 90.1 bits (222), Expect = 4e-18 Identities = 45/68 (66%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+RDD EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KGNEA NVTGP G Sbjct: 46 YGFINRDDTKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGS 105 Query: 178 AVQGSKFA 201 VQGSK+A Sbjct: 106 NVQGSKYA 113
>sp|P45441|YBX2B_XENLA Y-box binding protein 2-B (Cytoplasmic RNA-binding protein p54) (mRNP3) Length = 324 Score = 89.7 bits (221), Expect = 5e-18 Identities = 47/86 (54%), Positives = 63/86 (73%), Gaps = 2/86 (2%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 55 YGFINRNDSKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV 114 Query: 178 AVQGSKFAPNND-FQNRNHRDNANNS 252 V+GS+FAPN+ F+ + +R A+ + Sbjct: 115 PVKGSRFAPNSTRFRRQFYRPRADTA 140
>sp|Q9Y2T7|YBOX2_HUMAN Y-box binding protein 2 (Germ cell-specific Y-box binding protein) (Contrin) (MSY2 homolog) Length = 364 Score = 88.2 bits (217), Expect = 2e-17 Identities = 44/70 (62%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI R P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 107 YGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGV 166 Query: 178 AVQGSKFAPN 207 V+GS++APN Sbjct: 167 PVKGSRYAPN 176
>sp|P21573|YBOX1_XENLA Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) Length = 303 Score = 87.8 bits (216), Expect = 2e-17 Identities = 47/89 (52%), Positives = 61/89 (68%), Gaps = 2/89 (2%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 50 YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPEGV 109 Query: 178 AVQGSKFAPN-NDFQNRNHRDNANNSYRQ 261 VQGSK+A + N ++ R +Y+Q Sbjct: 110 PVQGSKYAADRNHYRRYPRRRGPPRNYQQ 138
>sp|P62960|YBOX1_MOUSE Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) sp|P62961|YBOX1_RAT Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) Length = 322 Score = 87.8 bits (216), Expect = 2e-17 Identities = 49/94 (52%), Positives = 60/94 (63%), Gaps = 10/94 (10%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 70 YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV 129 Query: 178 AVQGSKFA---------PNNDFQNRNHRDNANNS 252 VQGSK+A P RN++ N NS Sbjct: 130 PVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNS 163
>sp|P67809|YBOX1_HUMAN Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) sp|P67808|YBOX1_BOVIN Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) Length = 324 Score = 87.8 bits (216), Expect = 2e-17 Identities = 49/94 (52%), Positives = 60/94 (63%), Gaps = 10/94 (10%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 72 YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV 131 Query: 178 AVQGSKFA---------PNNDFQNRNHRDNANNS 252 VQGSK+A P RN++ N NS Sbjct: 132 PVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNS 165
>sp|Q06066|YBOX1_CHICK Nuclease sensitive element binding protein 1 (Y-box binding protein 1) (Y-box transcription factor) Length = 321 Score = 87.8 bits (216), Expect = 2e-17 Identities = 49/94 (52%), Positives = 60/94 (63%), Gaps = 10/94 (10%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP G Sbjct: 69 YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV 128 Query: 178 AVQGSKFA---------PNNDFQNRNHRDNANNS 252 VQGSK+A P RN++ N NS Sbjct: 129 PVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNS 162
>sp|Q9Z2C8|YBOX2_MOUSE Y-box binding protein 2 (Germ cell-specific Y-box binding protein) (FRGY2 homolog) Length = 360 Score = 86.3 bits (212), Expect = 6e-17 Identities = 43/70 (61%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI R P K +S+G+ E VEFDVV+G KG A NVTGP G Sbjct: 109 YGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGARAANVTGPGGV 168 Query: 178 AVQGSKFAPN 207 V+GS++APN Sbjct: 169 PVKGSRYAPN 178
>sp|Q00436|YB3_XENLA B box binding protein (YB3 protein) Length = 305 Score = 85.5 bits (210), Expect = 1e-16 Identities = 46/89 (51%), Positives = 61/89 (68%), Gaps = 2/89 (2%) Frame = +1 Query: 1 YGFIHRDDIDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGSKGNEAMNVTGPNGD 177 YGFI+R+D EDVFVHQ+AI + P K +S+G+ E VEFDVV+G KG EA NVTGP Sbjct: 50 YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGPV 109 Query: 178 AVQGSKFAPN-NDFQNRNHRDNANNSYRQ 261 VQGSK+A + N+++ R +Y+Q Sbjct: 110 PVQGSKYAADRNNYRRYPRRRGPPRNYQQ 138
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,573,671 Number of Sequences: 369166 Number of extensions: 694889 Number of successful extensions: 2466 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2247 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 4926080070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)