Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_011_D14-2 (487 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O13679|YJ15_SCHPO Hypothetical protein C737.05 in chromo... 30 2.3 sp|Q9DBS9|OSR3_MOUSE Oxysterol binding protein-related prot... 30 3.9 sp|Q9H4L5|OSR3_HUMAN Oxysterol binding protein-related prot... 29 5.0
>sp|O13679|YJ15_SCHPO Hypothetical protein C737.05 in chromosome III Length = 264 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 56 SCKQSIFLFLYHHYHHVSPVLLSFSLCHSLSN*FLLVFCRVPL 184 S + F ++YHH++P +S L SL FLL + R+ + Sbjct: 96 SSYDQLLYFRQNYYHHITPSAISSGLLVSLVLIFLLAYLRISI 138
>sp|Q9DBS9|OSR3_MOUSE Oxysterol binding protein-related protein 3 (OSBP-related protein 3) (ORP-3) Length = 855 Score = 29.6 bits (65), Expect = 3.9 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -3 Query: 482 EKKQRELLRVARENQEIMERIIDQKPQYSVKDWDDDWSQNLAYID 348 EK QRE RV EN ++ +P++ K DD W N Y++ Sbjct: 801 EKLQRERRRVLEENG------VEHQPRFFRKSSDDAWVSNGTYLE 839
>sp|Q9H4L5|OSR3_HUMAN Oxysterol binding protein-related protein 3 (OSBP-related protein 3) (ORP-3) Length = 887 Score = 29.3 bits (64), Expect = 5.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 482 EKKQRELLRVARENQEIMERIIDQKPQYSVKDWDDDWSQNLAYID 348 E+ QRE RV EN ++ +P++ K DD W N Y++ Sbjct: 833 EQLQRERRRVLEENH------VEHQPRFFRKSDDDSWVSNGTYLE 871
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,068,928 Number of Sequences: 369166 Number of extensions: 413378 Number of successful extensions: 1552 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 2921208590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)