Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_N10 (218 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9VQ62|NPC2_DROME Hypothetical protein NPC2 precursor (N... 48 6e-06 sp|Q9DGJ3|NPC2_BRARE Epididymal secretory protein E1 precur... 39 0.004 sp|P61917|NPC2_PANTR Epididymal secretory protein E1 precur... 37 0.011 sp|Q9Z0J0|NPC2_MOUSE Epididymal secretory protein E1 precur... 37 0.011 sp|Q25481|ES16_MANSE Ecdysteroid regulated 16 kDa protein p... 37 0.014 sp|P79345|NPC2_BOVIN Epididymal secretory protein E1 precur... 36 0.024 sp|O97763|NPC2_PIG Epididymal secretory protein E1 precurso... 35 0.069 sp|Q28895|NPC2_CANFA Epididymal secretory protein E1 precur... 32 0.34 sp|P27236|DCP_SALTY Peptidyl-dipeptidase dcp (Dipeptidyl ca... 29 2.9 sp|Q6BHL8|IPK1_DEBHA Inositol-pentakisphosphate 2-kinase (I... 28 6.5
>sp|Q9VQ62|NPC2_DROME Hypothetical protein NPC2 precursor (Niemann Pick type C2 protein homolog) Length = 148 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +1 Query: 25 YTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSI 141 YT ++ +L+ YP V V + WEL D DG DI+CV++P I Sbjct: 109 YTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKI 147
>sp|Q9DGJ3|NPC2_BRARE Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (16.5 kDa secretory protein) Length = 149 Score = 38.9 bits (89), Expect = 0.004 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 25 YTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSIVS 147 Y + + YP+++V + WEL D D+ C++ P IV+ Sbjct: 109 YVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQIVN 149
>sp|P61917|NPC2_PANTR Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (EPI-1) sp|P61918|NPC2_MACFA Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (Epididymal secretory protein 14.6) (ESP14.6) sp|P61916|NPC2_HUMAN Epididymal secretory protein E1 precursor (Niemann-Pick disease type C2 protein) (hE1) Length = 151 Score = 37.4 bits (85), Expect = 0.011 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 22 TYTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSIVS 147 +Y N + + YPS+++ + W+L D + C ++P IVS Sbjct: 108 SYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS 149
>sp|Q9Z0J0|NPC2_MOUSE Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (mE1) Length = 149 Score = 37.4 bits (85), Expect = 0.011 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 22 TYTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSIVS 147 +Y N + + YPS+++ + W+L D N++ C ++P I S Sbjct: 108 SYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS 149
>sp|Q25481|ES16_MANSE Ecdysteroid regulated 16 kDa protein precursor Length = 145 Score = 37.0 bits (84), Expect = 0.014 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 19 STYTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSI 141 + Y ++ +LK YP V V + WEL D D+VC+ +P I Sbjct: 105 ANYKTTLPVLKSYPKVSVDVKWEL-KKDEEDLVCILIPARI 144
>sp|P79345|NPC2_BOVIN Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (EPV20) Length = 149 Score = 36.2 bits (82), Expect = 0.024 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 25 YTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSI 141 Y N + + YPS++V + WEL D C Q+P + Sbjct: 109 YVNKLPVKNEYPSIKVVVEWELTDDKNQRFFCWQIPIEV 147
>sp|O97763|NPC2_PIG Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (16 kDa secretory protein) Length = 149 Score = 34.7 bits (78), Expect = 0.069 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 22 TYTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSIVS 147 +Y N + + YPS+++ + W+L D + + C Q+P I S Sbjct: 108 SYLNKLPVKAEYPSIKLVVEWKLQDDNDQCLFCWQIPVQIES 149
>sp|Q28895|NPC2_CANFA Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (cE1) Length = 149 Score = 32.3 bits (72), Expect = 0.34 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +1 Query: 22 TYTNSIDILKYYPSVRVTITWELIDADGNDIVCVQMPTSI 141 +Y N + + YPS+++ + W L+ + + C ++P I Sbjct: 108 SYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQI 147
>sp|P27236|DCP_SALTY Peptidyl-dipeptidase dcp (Dipeptidyl carboxypeptidase) Length = 680 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 22 TYTNSIDILKYYPSVRVTITWELIDADG 105 T+ DI Y+P VRV WE+ D+DG Sbjct: 380 TFVERFDIPVYHPDVRV---WEIFDSDG 404
>sp|Q6BHL8|IPK1_DEBHA Inositol-pentakisphosphate 2-kinase (Inositol-1,3,4,5,6-pentakisphosphate 2-kinase) (Ins(1,3,4,5,6)P5 2-kinase) (InsP5 2-kinase) Length = 377 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 186 IKLFILYNKFQRLTNNRSRHLNANNIITI-SVNKFPCYC 73 + LFI + K+ + N + H N NN+I I KF C Sbjct: 290 VGLFIKFEKYNKYNNIHNSHNNINNLINIEGYGKFLLTC 328
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,141,990 Number of Sequences: 369166 Number of extensions: 294337 Number of successful extensions: 550 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 68,354,980 effective HSP length: 44 effective length of database: 60,226,640 effective search space used: 1686345920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)