Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_E13 (286 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58710|COBD_METJA Probable cobalamin biosynthesis protei... 29 3.8 sp|O42690|CDR3_CANAL Opaque-specific ABC transporter CDR3 29 3.8
>sp|Q58710|COBD_METJA Probable cobalamin biosynthesis protein cobD Length = 307 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 269 NLFKTIGSIRKYL*FLFGNKTTFIQM 192 N+FK+ KY FLFG+ TTFI + Sbjct: 39 NIFKSTNCKNKYRDFLFGSLTTFITL 64
>sp|O42690|CDR3_CANAL Opaque-specific ABC transporter CDR3 Length = 1501 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 269 NLFKTIGSIRKYL*FLFGNKTTFIQMNCTNIRNLDNTVYR 150 N+++ G + ++ FLFG F+Q N ++I + V+R Sbjct: 750 NVWRNFGVLMAFIIFLFGTTIFFVQTNKSSISKGETLVFR 789
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,228,371 Number of Sequences: 369166 Number of extensions: 423092 Number of successful extensions: 829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 68,354,980 effective HSP length: 64 effective length of database: 56,531,940 effective search space used: 1695958200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)