Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_B12 (857 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q80U72|LAP4_MOUSE LAP4 protein (Scribble homolog protein) 32 3.0 sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [... 30 6.6
>sp|Q80U72|LAP4_MOUSE LAP4 protein (Scribble homolog protein) Length = 1612 Score = 31.6 bits (70), Expect = 3.0 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +1 Query: 562 KSISGDKLKDSGKFSPVRE---KRDILEEISEEDSQAPSNSPTSTEDDLLATS 711 KS+ D L+ S +E KR LE ++E S AP+ SPT ED L TS Sbjct: 1489 KSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTS 1541
>sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] Length = 1253 Score = 30.4 bits (67), Expect = 6.6 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +1 Query: 1 DLTRDEDKFYSGDSSPKSRKGRKHDESIEIDTSLNDSHNNSDS 129 D + D S DSS S D S D+S +DS N SDS Sbjct: 819 DSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDSSDSDSSNRSDS 861
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.304 0.126 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,424,201 Number of Sequences: 369166 Number of extensions: 1275594 Number of successful extensions: 1825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1823 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8486520240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)