Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_A15 (344 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9MUY3|MATK_ARUDO Maturase K (Intron maturase) 29 3.8 sp|P34670|YO14_CAEEL Hypothetical zinc finger protein ZK686... 28 6.6
>sp|Q9MUY3|MATK_ARUDO Maturase K (Intron maturase) Length = 513 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 125 FSILFLFLPNEEVFPIFQFLVE-HLIYSLKMESY-HLHFVSNLSI 253 FS+ LF P E+ P FQ L H I+ + + HLH++S++ I Sbjct: 111 FSLGELFCPEEKQIPKFQNLQSIHSIFPFLEDKFLHLHYLSHIEI 155
>sp|P34670|YO14_CAEEL Hypothetical zinc finger protein ZK686.4 in chromosome III Length = 407 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/35 (34%), Positives = 25/35 (71%) Frame = +3 Query: 240 QISQLIKSQLEDETAKYASMLKIEPTENKEREKDT 344 Q+ QL++ +++E A+ A K + T+N++R++DT Sbjct: 341 QVEQLLED-VQEEEARMADFKKDKKTDNRKRKRDT 374
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,772,880 Number of Sequences: 369166 Number of extensions: 440095 Number of successful extensions: 1119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 68,354,980 effective HSP length: 82 effective length of database: 53,206,710 effective search space used: 1702614720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)