Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_A08 (160 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalyti... 28 5.1 sp|Q17848|I5P1_CAEEL Probable type I inositol-1,4,5-trispho... 28 6.6
>sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit Length = 648 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -1 Query: 133 KTTNQRTSYLQTANPSTDGLRARHAASIYL--SIIHQHGH*RNNM 5 +T+ T+ T NP T GL +HA S Y +++H H ++++ Sbjct: 238 QTSTTTTTTTTTTNPHTSGLSLQHAHSSYTPSNVLHSPTHFQSSL 282
>sp|Q17848|I5P1_CAEEL Probable type I inositol-1,4,5-trisphosphate 5-phosphatase (5PTase) Length = 409 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -3 Query: 134 KNHQSTHELFANSQP*YRWSARASRSINIFINNPPAW 24 +N QS E+ N P Y WS S + PAW Sbjct: 331 ENFQSMFEMHINFPPTYPWSEDPENSETLMKTRAPAW 367
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,614,124 Number of Sequences: 369166 Number of extensions: 245155 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 68,354,980 effective HSP length: 25 effective length of database: 63,736,605 effective search space used: 1720888335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)