Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_L05 (185 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q836A6|LYAT_ENTFA Membrane-bound protein lytR 30 1.3 sp|Q9A710|MMPA_CAUCR Metalloprotease mmpA (membrane metallo... 29 3.8
>sp|Q836A6|LYAT_ENTFA Membrane-bound protein lytR Length = 303 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 168 IYFEFILVIWLVIFNIF*LLYWNITKTSSRSYNT 67 I F ILV++L + + LYW+++K+ ++Y T Sbjct: 10 IIFGIILVLFLAVVGMGAKLYWDVSKSMDKTYET 43
>sp|Q9A710|MMPA_CAUCR Metalloprotease mmpA (membrane metalloprotease A) Length = 398 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 7 LILVSLGCQFTESTSPQLNKGVVASAGGF--GDVPIK 111 +ILVS G Q T +T ++ G A+A GF GDV +K Sbjct: 136 VILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILK 172
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,907,682 Number of Sequences: 369166 Number of extensions: 149060 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 68,354,980 effective HSP length: 34 effective length of database: 62,073,990 effective search space used: 1675997730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)