Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_I23 (328 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9H4Q3|PRD13_HUMAN PR-domain zinc finger protein 13 34 0.12 sp|O95497|VNN1_HUMAN Pantetheinase precursor (Pantetheine h... 28 4.9
>sp|Q9H4Q3|PRD13_HUMAN PR-domain zinc finger protein 13 Length = 717 Score = 33.9 bits (76), Expect = 0.12 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 11/73 (15%) Frame = -1 Query: 205 CSAPPK---GIKAHP*-D*HTLPTLM*PFTIALPT*SGSLLLMQPPTTA-------FNGA 59 C+ PP G+KA+P + LP +M FT+ +G LL P TTA F G Sbjct: 444 CALPPLDPGGLKAYPGGECSHLPAVMPAFTVY----NGELLYGSPATTAYYPLKLHFGGL 499 Query: 58 CPFPQGIHAYSGP 20 +P+ I +SGP Sbjct: 500 LKYPESISYFSGP 512
>sp|O95497|VNN1_HUMAN Pantetheinase precursor (Pantetheine hydrolase) (Vascular non-inflammatory molecule 1) (Vanin-1) (Tiff66) Length = 513 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +3 Query: 24 PEYAWIPCGN----GQAPLNAVVGGCINNNEPLYV 116 PE WIPC N GQ P+ + C+ N +YV Sbjct: 102 PEVNWIPCNNRNRFGQTPVQERL-SCLAKNNSIYV 135
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,571,427 Number of Sequences: 369166 Number of extensions: 670083 Number of successful extensions: 1509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1509 length of database: 68,354,980 effective HSP length: 77 effective length of database: 54,130,385 effective search space used: 1678041935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)