Planarian EST Database


Dr_sW_009_G03

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_009_G03
         (369 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P68752|MATK_LILSU  Maturase K (Intron maturase) >gi|56749...    29   3.9  
>sp|P68752|MATK_LILSU Maturase K (Intron maturase)
 sp|P68751|MATK_LILMI Maturase K (Intron maturase)
 sp|P68750|MATK_LILCA Maturase K (Intron maturase)
          Length = 512

 Score = 28.9 bits (63), Expect = 3.9
 Identities = 19/64 (29%), Positives = 30/64 (46%)
 Frame = +3

Query: 126 FVKKKSLLSQHFYYNICCNFYQLFFGVQTNDSFNGILFSIEIR*LHLLNSFDDRFLKIGI 305
           ++KK   L QHF Y +    Y   + +  +DS NG +F   I  +   N F    +K  I
Sbjct: 7   YLKKDRSLQQHFLYPLLLQEY--IYTLAHDDSLNGSIFYEPIEFIGYDNKFSLVLVKRLI 64

Query: 306 VKMF 317
            +M+
Sbjct: 65  TRMY 68
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,586,153
Number of Sequences: 369166
Number of extensions: 531371
Number of successful extensions: 1136
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1108
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1135
length of database: 68,354,980
effective HSP length: 89
effective length of database: 51,913,565
effective search space used: 1713147645
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)