Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_E15 (451 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein bet... 78 8e-15 sp|O35353|GBB4_RAT Guanine nucleotide-binding protein beta ... 75 9e-14 sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein bet... 75 9e-14 sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein beta... 75 9e-14 sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I... 75 9e-14 sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein bet... 74 2e-13 sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/... 74 2e-13 sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I... 74 2e-13 sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/... 74 2e-13 sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I... 74 2e-13
>sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein beta subunit 1 sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein beta subunit 1 Length = 340 Score = 78.2 bits (191), Expect = 8e-15 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV+EDGMA+CTGSWDSFL++WN Sbjct: 305 AGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKIWN 340
>sp|O35353|GBB4_RAT Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 74.7 bits (182), Expect = 9e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFLR+WN Sbjct: 305 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN 340
>sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 74.7 bits (182), Expect = 9e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFLR+WN Sbjct: 305 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN 340
>sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein beta subunit Length = 341 Score = 74.7 bits (182), Expect = 9e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV+EDGMA+ TGSWDSFL++WN Sbjct: 306 AGVLAGHDNRVSCLGVTEDGMAVATGSWDSFLKIWN 341
>sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) Length = 340 Score = 74.7 bits (182), Expect = 9e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV+EDGMA+ TGSWDSFL++WN Sbjct: 305 AGVLAGHDNRVSCLGVTEDGMAVATGSWDSFLKIWN 340
>sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 +GVLAGHDNRVSCLGV++DGMA+ TGSWDSFLR+WN Sbjct: 305 SGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN 340
>sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62872|GBB1_CANFA Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) Length = 340 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFL++WN Sbjct: 305 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
>sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) Length = 326 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFL++WN Sbjct: 291 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 326
Score = 28.1 bits (61), Expect = 9.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 14 AGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGH V L ++ DG +G+ D+ +++W+ Sbjct: 167 AGHSGDVMSLSLAPDGRTFVSGACDASIKLWD 198
>sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) Length = 340 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFL++WN Sbjct: 305 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
Score = 28.1 bits (61), Expect = 9.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 14 AGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGH V L ++ DG +G+ D+ +++W+ Sbjct: 181 AGHSGDVMSLSLAPDGRTFVSGACDASIKLWD 212
>sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (XGbeta1) Length = 340 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 AGVLAGHDNRVSCLGVSEDGMAICTGSWDSFLRVWN 109 AGVLAGHDNRVSCLGV++DGMA+ TGSWDSFL++WN Sbjct: 305 AGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,470,223 Number of Sequences: 369166 Number of extensions: 897438 Number of successful extensions: 2638 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2635 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2444192520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)