Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_D02 (658 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P0A1W2|LEP_SALTY Signal peptidase I (SPase I) (Leader pe... 31 3.2 sp|Q7YJY0|RPOC2_CALFE DNA-directed RNA polymerase beta'' ch... 31 3.2 sp|P00803|LEP_ECOLI Signal peptidase I (SPase I) (Leader pe... 31 3.2 sp|Q19552|SRA29_CAEEL Serpentine receptor class alpha-29 (P... 30 4.2
>sp|P0A1W2|LEP_SALTY Signal peptidase I (SPase I) (Leader peptidase I) sp|P0A1W3|LEP_SALTI Signal peptidase I (SPase I) (Leader peptidase I) Length = 324 Score = 30.8 bits (68), Expect = 3.2 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 382 IKE*IYQRGRISTTWIKRNDNSKLKMIEKPKLDYL 278 IK+ IYQ+ I T KR D K E PKLDY+ Sbjct: 111 IKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYI 145
>sp|Q7YJY0|RPOC2_CALFE DNA-directed RNA polymerase beta'' chain (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1377 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -3 Query: 599 KLMQFKNCYYLI*HNEILNLRYLSL 525 K+ F + YYLI HN+IL +YLSL Sbjct: 987 KIANFDSSYYLITHNQILLNKYLSL 1011
>sp|P00803|LEP_ECOLI Signal peptidase I (SPase I) (Leader peptidase I) Length = 324 Score = 30.8 bits (68), Expect = 3.2 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 382 IKE*IYQRGRISTTWIKRNDNSKLKMIEKPKLDYL 278 IK+ IYQ+ I T KR D K E PKLDY+ Sbjct: 111 IKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYI 145
>sp|Q19552|SRA29_CAEEL Serpentine receptor class alpha-29 (Protein sra-29) Length = 348 Score = 30.4 bits (67), Expect = 4.2 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = +2 Query: 185 SSFINSAYSRTVSSCLESSFTCNATVFFSIQQI----VQFRFFNHFQFTIVVSFYPCCRY 352 S F++ +S S S T VF +Q I +QF F+ +T S+ P C Y Sbjct: 123 SLFLDRLFSLNPRSFYNSHQTLGFIVFLILQIICPIAIQFWTFHDSDYT---SYVPMCNY 179 Query: 353 PPA 361 PPA Sbjct: 180 PPA 182
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,299,365 Number of Sequences: 369166 Number of extensions: 1266157 Number of successful extensions: 3312 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3310 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5462583840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)